KEGG   Burkholderiales bacterium GJ-E10: E1O_26390Help
Entry
E1O_26390         CDS       T03654                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
bbag  Burkholderiales bacterium GJ-E10
Pathway
bbag00970  Aminoacyl-tRNA biosynthesis
bbag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbag00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    E1O_26390
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bbag03029]
    E1O_26390
Enzymes [BR:bbag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     E1O_26390
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     E1O_26390
Mitochondrial biogenesis [BR:bbag03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    E1O_26390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: BAP89770
UniProt: A0A0A1H8Z9
Position
complement(2819634..2819921)
Genome map
AA seq 95 aa AA seqDB search
MSLNLSDVYRIAHLARIEITDAQAQEAAGQLNDIFAMIERIARVDTAGVAPMSHPLDGVQ
RLRADAVTEVPDRERTMGNAPARQDGLFLVPRVIE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaaatttatccgacgtgtaccggattgcccatctcgcgcgcatcgagatcacc
gacgcgcaagcccaggaagccgctggccagctcaacgacatctttgcgatgatcgagcgg
atcgcgcgcgtggacacggccggggtggcgcccatgtcccatccgctcgacggcgtccag
cgcctgcgcgccgatgccgtgaccgaggtgcccgatcgggaacggacgatgggcaacgcg
cccgcccggcaggatggcctgttcctggttccccgggtgatcgaatga

DBGET integrated database retrieval system