KEGG   Burkholderiales bacterium GJ-E10: E1O_29950Help
Entry
E1O_29950         CDS       T03654                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
bbag  Burkholderiales bacterium GJ-E10
Pathway
bbag00270  Cysteine and methionine metabolism
bbag00480  Glutathione metabolism
bbag01100  Metabolic pathways
Module
bbag_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:bbag00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    E1O_29950
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    E1O_29950
Enzymes [BR:bbag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     E1O_29950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: BAP90126
UniProt: A0A0A1H726
Position
3187582..3188571
Genome map
AA seq 329 aa AA seqDB search
MTFLFVLDPLEALKPAKDSSIAMMRELQRRGHEVWACTPRTLAWEAGAVWAESARRIALP
DGTGGAPWFAVQETRSRALAEFDAVLMRKDPPFDLEYLYATHLLEAAVRAPRPARVFNDP
RALRDHNEKLAITEFAEFIPPTLVSSDPARILRFREEHGGIVVKPLDGMGGAGVFRIEAG
DPNTNAILETVTRLGTRTVMAQRFLPEIAQGDKRILLIGGAPAPFALARIPKPGDARGNL
AAGGTGRAQPLSARDRQIAEHVGPVLAARGLLLVGLDVIGDFVTEINVTSPTCFVEIEAQ
TGFSVASMFVEELERRVGIPSAPAMRKRD
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcctgttcgtcctcgatccgctggaagcgctcaagccggcgaaggactcgagc
atcgccatgatgcgcgagctgcagcgccgcgggcacgaggtctgggcgtgcacgccccgc
accctggcatgggaagcgggtgcggtgtgggcggaatccgcccgccgcatcgcgctgccg
gatgggaccggtggggcgccctggtttgcggtgcaggaaacgcggtcgcgggcgctggcg
gagttcgacgccgtgctgatgcgcaaggatccgccattcgatctcgaatatctgtacgcc
acccatctgctggaggcggcggtgcgcgcaccccggccggcgcgcgtcttcaacgatccg
cgcgccttgcgggaccacaacgaaaagctcgcgatcaccgaattcgcggagttcatcccg
cccacgctggtgagcagcgatcccgctcgcatcctgcgttttcgcgaggagcacggaggc
atcgtcgtcaagccgctcgatggcatgggcggcgcgggcgtattccggatcgaggccgga
gacccgaacaccaacgcgatcctggagaccgtgacgcgcctcgggacacggaccgtcatg
gcgcagcgttttctgcccgaaatcgcccagggagacaagcggatcctgctgatcggcgga
gcgccggcaccgttcgccctggcgcgcatccccaagccgggcgatgcgcgcggcaacctc
gccgccggcgggaccggccgcgcacagccgctcagcgcccgcgaccggcagatcgccgag
catgtcgggccggtgctcgccgcacggggcctgctgctggtggggctggacgtgatcggc
gatttcgtcaccgaaatcaacgtcacgagcccgacctgcttcgtggagatcgaagcccag
accggattttcggtcgcgtcgatgttcgtcgaggaactggaacggcgcgtcggcatccct
tccgcccccgcgatgcgcaagcgagactga

DBGET integrated database retrieval system