KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_0506Help
Entry
Bdt_0506          CDS       T02356                                 

Gene name
bsaA
Definition
(GenBank) hypothetical protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
bbat00480  Glutathione metabolism
bbat00590  Arachidonic acid metabolism
bbat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    Bdt_0506 (bsaA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Bdt_0506 (bsaA)
Enzymes [BR:bbat01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Bdt_0506 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AFY00214
UniProt: K7Z7D0
Position
complement(514431..514916)
Genome map
AA seq 161 aa AA seqDB search
MKKHLYDFTVKAANGQPVSLDQYRDKVVLVVNVASKCGYTPQYKGLEELYLQNKDNGLVI
LGFPCNQFGAQEPGSNEEIQQFCELNYGVSFPVMGKVDVNGGNADPLYQWMKEEAPGLLG
TEMIKWNFTKFLIGKDGAVLKRFAPKDEPKDIADDVKKALA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcatctttatgatttcaccgtcaaagccgccaatggccagcccgtgtccctg
gatcaataccgcgacaaagtggtgttggtggtcaacgtagccagcaagtgtggttacact
cctcagtacaagggccttgaagaactgtatctgcagaacaaagacaacggtctggtcatt
ctgggtttcccctgcaaccagttcggcgcacaagagccgggctccaatgaagagatccag
cagttctgtgaactgaactatggtgtgtccttcccggtgatgggcaaagtcgatgtgaac
ggcggcaatgcggatcctctgtatcagtggatgaaagaggaagctccgggtctgctggga
actgaaatgatcaaatggaatttcacaaaattcctgattggaaaagacggagcagtgctg
aaacgttttgctccgaaggacgagcccaaagacatcgcggacgacgtcaaaaaagccctg
gcttag

DBGET integrated database retrieval system