KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_1511Help
Entry
Bdt_1511          CDS       T02356                                 

Definition
(GenBank) pseudouridine synthase Rlu family protein
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Brite
KEGG Orthology (KO) [BR:bbat00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bbat03016]
    Bdt_1511
Enzymes [BR:bbat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     Bdt_1511
Transfer RNA biogenesis [BR:bbat03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    Bdt_1511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AFY01207
UniProt: K7ZF65
Position
complement(1598681..1599403)
Genome map
AA seq 240 aa AA seqDB search
MELLYKDEYFIAVNKPSGFHVHPHENVQHRVSRDKICLYHARRMMKQHVYPVHRLDAGTS
GVLLFALSSESASKLCRLFTERATHKTYQAVVRGYVKEEGEVELPLELDSTGDLVDARTS
FKRLATVEFPVAVGKKFPTARYSWVEVIPHTGRYHQIRRHFNRISHPLLGDAVHGDSHHN
RFFRNHLDIEGLCLKALRMEFTHPWSGEKVSIEAPHCEKWKKIQLLFDPGLPPESKLKSL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtggagctactgtacaaagatgaatactttattgccgtgaacaagccctcaggctttcac
gtgcatccccacgagaatgtccagcaccgtgtttcccgcgataaaatctgtctttaccat
gcccgccgcatgatgaaacagcacgtgtatccggtgcatcgcctggatgccggcaccagt
ggcgtgctgctgtttgcactttcttcggaatccgccagcaaactgtgccgcctgttcacc
gaacgcgcgacccataaaacctatcaggctgtggtgcgcggttacgtgaaagaagaaggt
gaagtagagctgccgttggaactggattccaccggcgacctggtggacgctcggaccagc
ttcaaacgcctggcgaccgtggaattcccggtggctgtcggtaaaaagttccccaccgcc
cgctattcgtgggtagaggtcatcccccacaccggccgctaccaccagatccgccgacat
ttcaatcgcatctcccatcccttgctgggggacgccgttcacggggattcccaccacaac
cgtttcttcagaaaccacttggatatcgagggtttgtgcctaaaagccctgcgcatggag
ttcactcacccctggagtggcgaaaaagtctctatcgaggccccgcactgcgagaaatgg
aagaaaattcaacttctgtttgatcctgggctcccgcccgaaagcaaactgaaatccctt
tga

DBGET integrated database retrieval system