KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_2033Help
Entry
Bdt_2033          CDS       T02356                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
bbat00071  Fatty acid degradation
bbat00072  Synthesis and degradation of ketone bodies
bbat00280  Valine, leucine and isoleucine degradation
bbat00310  Lysine degradation
bbat00362  Benzoate degradation
bbat00380  Tryptophan metabolism
bbat00620  Pyruvate metabolism
bbat00630  Glyoxylate and dicarboxylate metabolism
bbat00640  Propanoate metabolism
bbat00650  Butanoate metabolism
bbat00900  Terpenoid backbone biosynthesis
bbat01100  Metabolic pathways
bbat01110  Biosynthesis of secondary metabolites
bbat01120  Microbial metabolism in diverse environments
bbat01130  Biosynthesis of antibiotics
bbat01200  Carbon metabolism
bbat01212  Fatty acid metabolism
bbat02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbat00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bdt_2033
   00630 Glyoxylate and dicarboxylate metabolism
    Bdt_2033
   00640 Propanoate metabolism
    Bdt_2033
   00650 Butanoate metabolism
    Bdt_2033
  Lipid metabolism
   00071 Fatty acid degradation
    Bdt_2033
   00072 Synthesis and degradation of ketone bodies
    Bdt_2033
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bdt_2033
   00310 Lysine degradation
    Bdt_2033
   00380 Tryptophan metabolism
    Bdt_2033
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bdt_2033
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bdt_2033
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bdt_2033
Enzymes [BR:bbat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bdt_2033
Exosome [BR:bbat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bdt_2033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AFY01719
UniProt: K7ZAI2
Position
complement(2131572..2132855)
Genome map
AA seq 427 aa AA seqDB search
MSNRKTMRPVAILAGSRTPFTKSFTNYSRTSNRELMTATVRDLVDKTQLRGALLGDVSLG
AVMKNASDWNLARETVLGAGLDPHTPGYDVQRACGTGLETVAQIALKIASGQIESGIGGG
TDTNSDIAGVLPHEFSWIMMEAQKEKTLGGRLKKFAELKLQYLKPRFPNVQEPRTGKSMG
DHTEMMVKDWMITREAQDELAYHSHQNAAKAYAEGFYKDLVFDFKGLKQDIFVRPDTTME
KLAKLKPAFDFNGTGTLTAGNSTPLTDGASAVLLGSEEFAKEKNLPVLAYFVDADYAAVD
FVKGEGLLMAPTRAVANLLRRNNLTLQDFDFYEIHEAFAGQVLCTLKAWEDEEYCRTQLG
WDKALGSIDRSKMNVKGGSLALGHPFAATGGRIVASLSKMLAQKGSGRGLISICTAGGMG
VAAIIER
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaccgtaaaaccatgagacccgtcgccatcctggccggctccagaactccgttc
acgaaatccttcacgaattattcccgcacctccaatcgtgagctgatgacagccacggtg
cgtgatctggtcgacaagacccagctgcgcggggccttgttgggggatgtgtctttgggg
gctgtgatgaaaaatgcctcggactggaacctggcccgtgaaactgttctgggggcagga
cttgatccgcacacaccgggttatgacgtacaacgtgcctgcggtacgggtcttgagacc
gtggcgcaaatcgctttgaaaatcgcttcaggccagatcgaaagcggcatcggtggcggt
acggacaccaacagtgatatcgccggtgttttgccccatgagttttcctggatcatgatg
gaagcccaaaaagaaaaaacactgggtggccgtctgaaaaagttcgcagaattaaaactt
caatatctgaaaccacgcttcccgaatgtgcaggaaccgcgcaccggcaaatccatgggt
gatcacacagaaatgatggtgaaagactggatgatcacgcgcgaagcgcaggatgaactg
gcttaccacagccatcagaatgcggcgaaggcctatgctgaggggttctataaggatctg
gtttttgatttcaaaggtctgaaacaggacatctttgttcggccggacacgacaatggaa
aaattggcaaagctgaaacccgcatttgatttcaacggcaccggcacgctaacagccggg
aacagcactccgttgacggatggagcttccgcagttctgttgggcagtgaggaatttgcc
aaagaaaaaaaccttccggtgctggcgtactttgttgatgcagactatgctgccgtggac
tttgtaaaaggcgaaggtcttttgatggcgccgactcgcgcggtggccaatctgcttcgt
cgcaacaacctgacgctgcaggattttgatttctatgaaatccacgaagccttcgcaggc
caggtgttgtgcacattgaaagcctgggaagatgaagagtactgccgcacacaactgggc
tgggacaaggccttgggttccattgatcgttccaaaatgaacgtcaaaggtggaagcctg
gctttggggcacccgttcgctgcaactggcggccgtattgtggcaagtctttccaagatg
ctggcgcaaaaaggttccggccgtggattgatctctatctgtaccgcaggcggtatgggt
gtggccgcgatcattgaaagatag

DBGET integrated database retrieval system