KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_2490Help
Entry
Bdt_2490          CDS       T02356                                 

Gene name
apaG
Definition
(GenBank) ApaG
  KO
K06195  ApaG protein
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Brite
KEGG Orthology (KO) [BR:bbat00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Bdt_2490 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AFY02173
UniProt: K7YWV9
Position
2631389..2631778
Genome map
AA seq 129 aa AA seqDB search
MAMQKTSIPDFQITAKVVYVPTESRPAEGYHFFAYKIAITNTGSTPAQLMSRHWVITDAL
GKKEEVRGPGVVGLQPKIQPGQTFEYDSACPLTTSTGSMVGRYFFVGESGESFSVEVPEF
YLIAPLALH
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgcaaaaaacttcaatccctgatttccaaatcaccgcgaaagtcgtctacgtc
cctacagagtcgcgacccgctgaaggctatcatttctttgcctataaaattgccatcacc
aacaccggatcaactcctgcccaactgatgagccgtcactgggttatcaccgatgctttg
ggcaaaaaagaagaagtccgcggccctggcgttgtcggattacagcccaaaattcagccc
ggtcaaacctttgaatatgacagcgcttgccctctgacaacgtccaccggcagtatggtg
ggacgttatttcttcgtgggtgaaagtggcgagagcttctcggtggaagtaccggagttt
tatctgatcgctcctttggcgctgcattaa

DBGET integrated database retrieval system