KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_2587Help
Entry
Bdt_2587          CDS       T02356                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
bbat00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bbat00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bdt_2587
Enzymes [BR:bbat01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bdt_2587
Transporters [BR:bbat02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bdt_2587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AFY02270
UniProt: K7YZV9
Position
2736369..2736995
Genome map
AA seq 208 aa AA seqDB search
MQRNLKMNLFYSPGACALASQIALREAGMNFEMVKVDLKNKEYAGGDYKKVNPKGYIPAL
QLPDGHLMTEGAVILQWIADQAPDKNLLPKFGTMERYKAMEWLNFIATEVHKGIGSLFNS
AHMNDETKAAIQAKIQLRLGVLDQHLLSNAYMLGENFSVVDAYAYNVLRWTNLVHVDTTN
HKGIQGLMAKMAERASVKEAVAAEGIRL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaggaatctgaaaatgaatctgttttattctcctggtgcctgtgccctggcttct
caaatcgcgttgcgtgaagccggcatgaacttcgaaatggttaaagttgatctgaaaaac
aaagaatacgctggcggcgactacaaaaaagtaaacccaaaaggttacatccctgccctg
caactgcctgacggtcatttgatgacggaaggtgcggtgatcttgcagtggatcgcggat
caggctccagacaaaaatcttttgccgaaattcggcactatggagcgctacaaggcgatg
gagtggctgaactttatcgcgactgaggtgcacaagggtattggttcccttttcaattct
gcacacatgaacgacgaaaccaaagcggccattcaggcaaaaatccaattgcgtctgggc
gtcttggatcagcaccttctgagcaacgcctatatgttgggtgaaaacttctctgtcgtt
gatgcttacgcttacaacgttcttcgctggacgaacctggttcatgtcgacacgacaaac
cacaagggcatccaaggccttatggctaaaatggcagaacgcgcttccgtgaaagaagcg
gttgcggcagaaggcatccgtctttag

DBGET integrated database retrieval system