KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_3467Help
Entry
Bdt_3467          CDS       T02356                                 

Gene name
dfp
Definition
(GenBank) flavoprotein
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
bbat00770  Pantothenate and CoA biosynthesis
bbat01100  Metabolic pathways
Module
bbat_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bbat00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Bdt_3467 (dfp)
Enzymes [BR:bbat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Bdt_3467 (dfp)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     Bdt_3467 (dfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein DFP Epimerase
Motif
Other DBs
NCBI-ProteinID: AFY03142
UniProt: K7ZH57
Position
3684210..3685481
Genome map
AA seq 423 aa AA seqDB search
MSKSKVLFMMTGSIACYKACHVVSRLVQNNCDVQVVASPSALKFVGNATLEGLTGKPVIS
DMYATGNVMDHIHLMRWADVILVAPATANFINKAAQGVGDDLLQTLFLAHDFKKPFLVAP
AMNTSMYLHPVTQKSLTALKEMGVQILDTASGILACGEEGWGKLLEPDLILKMTLEALHK
PAQDTAAVSVAPKSSALSKVKILITAGGTQEPIDTVRVISNLSSGRTGIALAEYMTQMGF
DVTLLQAHASPKSEHVTRRDLFVSFATLDEKMKHYLSTENFTHVIHAAAVSDYSIDHLEV
DGQSFRPFEVKKVSSESDKMSIHLKRNHKIVDRLKEYSKNKDLKVIAFKLTSHASPEQRT
HAVEKLFANSHADFVVHNDLSEIDIVNRTHKFTLFNHEGFVACENLDQLTSELIRVVLPK
DTV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaatctaaagttcttttcatgatgacaggctctattgcctgttacaaagcctgt
catgtggtttcccgtctggtgcagaataactgtgacgttcaggttgtggcctccccgtcg
gctttgaaatttgtcggcaacgccaccctggaaggcctgactggaaaacccgtcatcagt
gacatgtatgccaccggcaacgtcatggatcatatccacctgatgcgctgggcggatgtg
attttggtcgcccctgccacggcgaacttcataaacaaggctgctcaaggcgtgggtgat
gatttgctgcagactttgttcctggctcacgactttaaaaagccattcctggtggctccg
gccatgaacaccagtatgtatctgcacccggtgacacaaaagtccctgaccgctcttaaa
gaaatgggcgtgcaaatcctggacaccgcttccggcattctggcctgtggcgaagaaggc
tggggcaaactgctggaaccggatctgattctgaaaatgactttggaagcacttcacaag
ccagcgcaggataccgcggcggtttctgtggcgccaaagtcctctgccctttccaaagtg
aaaatcctgatcactgccgggggcacgcaagaacccatcgacacggttcgcgtaatcagc
aatcttagctcgggccgcaccggcatcgcgctggcggaatacatgacccaaatgggcttt
gatgtgaccttgctgcaagcccatgcttcacccaagtctgaacacgtcacccgccgtgat
ctgttcgtcagcttcgcgactttggatgaaaaaatgaaacactatctttccaccgaaaac
ttcacccacgtgattcacgctgcggccgtcagtgattattccattgatcatctggaagtg
gatggacagtctttccgcccgtttgaggtgaaaaaagtcagctcggaatccgacaagatg
agcattcacctaaagcgcaaccacaagattgtggaccgtctgaaggaatattccaaaaac
aaggacttgaaagtgattgcgttcaaactgaccagtcacgccagtcctgaacaacgcaca
cacgcagtggaaaagctttttgccaattcccacgccgacttcgtcgttcacaatgattta
agcgaaattgatatcgtcaaccgcacccacaaattcaccctgttcaatcacgaaggcttt
gttgcctgtgaaaatctggatcaactgaccagtgaactgattcgtgtggttctgccaaag
gatactgtatga

DBGET integrated database retrieval system