KEGG   Bacteroidetes bacterium: AEM51_04700Help
Entry
AEM51_04700       CDS       T04336                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bbau  Bacteroidetes bacterium
Pathway
bbau00480  Glutathione metabolism
bbau00590  Arachidonic acid metabolism
bbau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbau00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AEM51_04700
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AEM51_04700
Enzymes [BR:bbau01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AEM51_04700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin AHJR-like
Motif
Other DBs
NCBI-ProteinID: AMS28065
UniProt: A0A142L769
Position
complement(1094078..1094584)
Genome map
AA seq 168 aa AA seqDB search
MKSTTVNVQNIYSFNVQNIKGKIVELSAYKNKVVLIVNTASECGFTPQYKELEQLYNNYK
EKGFEILAFPSNDFGKQEPLAGKNLQNFCELHFRISFPLFEKVIVTGHRAIPLFQFLSTK
SLNGKVNMSPKWNFQKYLINRKGEVVDYFFPFTRPTSASISKAIERLI
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcaacaacagtaaacgttcaaaacatatattccttcaatgttcaaaacatcaaa
ggtaaaatcgttgaactttcagcgtacaaaaacaaagtagtgttaattgtaaacacagca
tcggaatgtggctttacaccccaatacaaagaactggagcagttatacaataactacaaa
gaaaaagggtttgagatattggcattcccatcaaatgatttcggtaaacaagaacctctg
gcaggtaagaatttacaaaatttttgcgaattacactttcgcatttcattcccattgttc
gaaaaagtgattgtcacaggacatagagccattcctctatttcaatttttaagcacaaaa
agtttaaatggcaaggttaatatgagtcccaaatggaactttcaaaaatacctcattaac
cgaaaaggcgaggtagttgattatttctttccgtttacacgtccaacttccgcaagtatt
agcaaggctattgaaaggttgatttag

DBGET integrated database retrieval system