KEGG   Bacteroidetes bacterium: AEM51_08000Help
Entry
AEM51_08000       CDS       T04336                                 

Definition
(GenBank) hexapeptide transferase
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
bbau  Bacteroidetes bacterium
Pathway
bbau00520  Amino sugar and nucleotide sugar metabolism
bbau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AEM51_08000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bbau01005]
    AEM51_08000
Enzymes [BR:bbau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     AEM51_08000
Lipopolysaccharide biosynthesis proteins [BR:bbau01005]
 Unusual sugar
  AEM51_08000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: AMS26966
UniProt: A0A142L420
Position
complement(1810202..1810789)
Genome map
AA seq 195 aa AA seqDB search
MEKAEQQYFAHETAIVDEGCTIGPGTKIWHFSHIMSNCTLGNNCNIGQNVVVSPEVVLGN
NVKVQNNVSIYTGVTCESDVFLGPSMVFTNVINPRSAVNRRGQYSKTNVGKGASIGANAT
IVCGHNIGKYAFIGAGAVVTKEVPDYALVVGNPAKQIGWKSEYGQKLAFDKNGKAICSES
GQEYKLETNKVIRVK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggcagaacagcaatattttgcacacgaaacggcaattgttgatgaaggttgt
accatcggacctggaacgaagatctggcatttttcgcatattatgtcaaactgtacgtta
ggtaataattgcaatattggtcaaaacgtagtggtatcgcccgaggtggttttgggaaac
aatgtaaaagtgcaaaacaatgtatccatatacacgggtgttacctgtgagtcggatgtg
tttttaggtccctcaatggtatttacgaatgtgattaatcctcgtagtgctgtgaatagg
agagggcagtattcgaaaacaaatgtgggtaagggagctagtattggagccaatgcaact
attgtatgcggacacaatatcggtaaatatgcctttatcggagcgggagcagtggtaacg
aaagaagttccagactatgcactcgttgtaggaaatccagccaaacaaatagggtggaag
agcgaatacggtcaaaaattagcgttcgataaaaatggtaaggcaatttgttcagaaagc
ggccaggagtataagttagaaacaaataaggttattagagttaaataa

DBGET integrated database retrieval system