KEGG   Burkholderiales bacterium YL45: A4V04_06645Help
Entry
A4V04_06645       CDS       T04607                                 

Definition
(GenBank) tRNA lysidine(34) synthetase TilS
  KO
K04075  tRNA(Ile)-lysidine synthase [EC:6.3.4.19]
Organism
bbay  Burkholderiales bacterium YL45
Brite
KEGG Orthology (KO) [BR:bbay00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bbay03016]
    A4V04_06645
Enzymes [BR:bbay01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.19  tRNAIle-lysidine synthase
     A4V04_06645
Transfer RNA biogenesis [BR:bbay03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    A4V04_06645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_3 TilS_C TilS
Motif
Other DBs
NCBI-ProteinID: ANU66128
UniProt: A0A1C7HHC7
Position
complement(1469222..1470619)
Genome map
AA seq 465 aa AA seqDB search
MSILPSAAKEVNAAIEKLYKDLSERGDGLESFVNKKVDLVVAVSGGCDSVSLLKAIAGYE
SPLKGRVICVYVNHHISPNADKWAAKCKARAKKLNVEFVEKDVFIRSKEQGLEAEARTLR
YRALNEVAEAENCSAIVTAHHLDDQIETFLIQWMRGSGLSGLIGMPYIKEGKIPVVRPFL
KIPRKRLETYARSQHLRWVEDDSNTDESYLRNFLRLNVIPELERARAGFKSAAGRSIEIL
AETSQILNEVDEKALQKCLDEDGNVRLDRWQKFSLPLQARVFRLWLQKKEFPPLPRTRLE
EILRQIRESKKKAICLRSQGKKSIVVNGRTLLIREVASDENPDYSVEFTWNGEKEMRFKG
LAGTLRFVESPDGFEDCYLKKKPLLFTLAKRSRTRIKIKKLRPSKTLKALYQEMNISEYE
RGKVPKIIRDGKLIYVAGIGEEIREKLYQGNGKKYSFEWVEDHLL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagcatactgcccagtgctgctaaagaggttaacgctgctatagaaaagctctataag
gatctctctgaacgcggtgacggcttagagagtttcgttaataagaaagtagatcttgtc
gtggcagtatcgggaggctgtgattccgtcagtctccttaaagctatcgctgggtatgaa
tcacctttgaagggccgagtaatctgtgtttatgttaatcatcatatttctcccaatgcg
gataaatgggcggctaaatgcaaagcccgagcaaagaaacttaatgttgagttcgtagaa
aaagacgtttttattcgcagcaaagaacaagggcttgaggccgaggccagaactttacgc
tacagggcgctcaatgaagtagcggaggctgaaaactgttcggctattgtgacggcacac
cacttagatgaccaaatcgaaacctttttgattcaatggatgagaggttcggggctcagc
gggttgatcggtatgccttacatcaaggaaggaaaaattcctgtcgtccgtccgtttttg
aagattcccaggaaacgccttgagacgtatgcaagaagccaacatttgcgctgggtggag
gatgacagcaacactgacgaatcttatcttagaaattttttacggctcaatgtcatcccg
gagcttgagcgcgcaagggcaggctttaaatctgccgccggccgcagcattgaaattttg
gcagaaacctctcaaattcttaatgaggttgatgagaaagcgcttcagaagtgtttagac
gaggatggaaatgtccgattagacaggtggcagaaattttctcttccgctgcaagctaga
gtattcagattgtggctgcagaaaaaagaatttcctccgcttccgcgcactcgacttgag
gaaatcctcagacagattagagagagcaagaaaaaggcaatatgtcttcgctcacaaggc
aaaaagtcaatcgttgtgaatggaagaactcttcttataagagaagtagcttctgatgaa
aatccggattattccgttgaatttacttggaacggcgaaaaagagatgcgcttcaaggga
ttagcgggtactttgcggtttgttgaaagtcccgacgggttcgaggattgttatctgaag
aaaaaaccgcttctgtttactttggctaagagatcccgtactcgtatcaaaataaaaaaa
ttaagaccttcaaagacattaaaagctctttaccaagagatgaatatttccgagtatgaa
agagggaaggtgcctaagattattcgtgacggtaaattaatttatgtggccggaatcggc
gaagaaattcgagaaaaactttatcaaggaaacggcaagaagtactccttcgaatgggtt
gaggatcatctcctttaa

DBGET integrated database retrieval system