KEGG   Burkholderiales bacterium YL45: A4V04_07180Help
Entry
A4V04_07180       CDS       T04607                                 

Definition
(GenBank) molybdopterin adenylyltransferase
  KO
K03831  molybdopterin adenylyltransferase [EC:2.7.7.75]
Organism
bbay  Burkholderiales bacterium YL45
Pathway
bbay00790  Folate biosynthesis
bbay01100  Metabolic pathways
bbay04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:bbay00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A4V04_07180
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    A4V04_07180
Enzymes [BR:bbay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     A4V04_07180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_2 MoCF_biosynth FSH1 Hydrolase_4 DLH Peptidase_S9 Abhydrolase_6 DUF2974
Motif
Other DBs
NCBI-ProteinID: ANU66224
UniProt: A0A1C7HI24
Position
1582676..1583929
Genome map
AA seq 417 aa AA seqDB search
MNKNTRIGLVSISDRASQGTYKDLGIPSLKDWLKKVILNPFEVEERLIPDDKETIKAVLK
ELVDEKKCDLVLTTGGTGPARRDVTPDATLEIATREVPGFGEQMRRISSVFVPTAILSRQ
VGALRETEDHAALIINLPGQPKAIAETLEGLPAKGVNGVFAAVPYCIELIGGPTIETDAT
YVKAFRPKSAKRPEIIDSLILEPEGKADSAIIMLHGLGADGSDFGHFREELIASGAPLES
TRMVLPNAPYIPISMNNGYEMRGWFDLYSLESRDREDAEGIKKTFQLIRRLISEEESKGI
PRDRIFLGGFSQGCCMTLYAAVQLDKPIGGFFGLSGYLPLIDKEEVEHVGSAIKSPIFIG
YGEEDSVVPPAFTQISVSYLRKLGADKLSAHGYPGLQHSIDLDEIGDLADFLATVLR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaatactcgaatcggcttagtttctatttcagatcgtgcttctcaaggcact
tataaagatttgggaattccttcgcttaaagactggctcaaaaaagtcatcctgaatccg
tttgaagtcgaagaaagacttattcccgatgataaagaaacgattaaagccgttttgaaa
gaactggttgatgaaaaaaaatgcgatttagttctgaccaccggcggcactgggcctgca
cgcagagacgtcacacctgatgccactttagaaatcgcaaccagagaggtgcccggattc
ggagaacaaatgagaagaatttcttccgtttttgttccgaccgctattctgtcccgtcaa
gtaggtgcattaagagaaaccgaagaccacgctgctctcatcattaatcttccgggtcag
cctaaggccattgcagagactttagagggtctccctgctaaaggcgttaacggcgtattt
gctgccgttccttactgcatagaattaatcggcggtccgactattgaaacggatgccaca
tacgttaaagccttccgtccgaaatctgccaagcggcctgaaatcatagattctctgatt
cttgagcctgaaggaaaagccgactccgccatcattatgcttcatggcttgggagccgac
ggaagcgattttgggcatttcagagaagagctgattgcaagcggcgctcctcttgaaagc
acaagaatggtcttacctaacgctccgtatattccaatctcaatgaacaacggatatgag
atgcggggttggttcgatctttacagtctcgaaagcagagacagagaggacgcagaggga
atcaaaaaaacattccaactcatccgcagattaatttccgaagaagaatctaaaggcatt
ccaagagaccgaattttcttaggtggattttctcaaggttgctgcatgactctttacgca
gctgtccagcttgataagccgatcggaggcttcttcggattgagcggatacctcccgtta
attgataaagaagaagttgagcacgtggggagcgctatcaaatctccaatcttcatcggt
tatggagaagaagattctgtcgtgccccctgcctttacccaaatctccgttagctacctc
cggaaactcggtgcagacaaactttcagcccatggctatccaggcctgcagcactcaata
gatctcgacgaaatcggagatttagctgacttcttggcgaccgttctgaggtag

DBGET integrated database retrieval system