KEGG   Burkholderiales bacterium YL45: A4V04_08625Help
Entry
A4V04_08625       CDS       T04607                                 

Definition
(GenBank) glycine--tRNA ligase subunit beta
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
bbay  Burkholderiales bacterium YL45
Pathway
bbay00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bbay00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A4V04_08625
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bbay01007]
    A4V04_08625
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bbay03016]
    A4V04_08625
Enzymes [BR:bbay01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     A4V04_08625
Amino acid related enzymes [BR:bbay01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   A4V04_08625
Transfer RNA biogenesis [BR:bbay03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    A4V04_08625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1 5_3_exonuc NifW
Motif
Other DBs
NCBI-ProteinID: ANU66471
UniProt: A0A1C7HGM3
Position
complement(1928242..1930332)
Genome map
AA seq 696 aa AA seqDB search
MNSLLVEIQTEELPPKALKKLSDAFSQEVFTQLKKADFLLPDSKMKAFGAPRRIAVYITD
VLADSPDKPFSQRLVPSKIGIGADGKPTAALIKKLAALGVQADVSELKVVNDGKQDQLYY
EGVKKGESLEKGLQNALDYAVTHLPIPKIMSYQLANGETVEFVRPVKHLLALYGDKVLNV
SLFGLKAGNQTAGHRFHTKDLLTINSADTYETQLEEQGKVIPSFEKRQDKMVAALKSEAA
NLNAQIIMPEDLVNEVASLTEWPVVYVSSFDEDFLKVPEECLILTMQQNQKYFALRDQNG
KLINKFLVVSQINAKDGGAAIQSGNARVVRARLADAKFFFEQDQLERLDSRVPGLEHVVY
HNKLGNQLQRSERIQNIAEKVAEKLGANPELAKRGAKLAKADLRTLMVGEFPELQGIMGE
YYALHDKEDPIVAVSIKEHYYPRYAGGELPSTPESLSVALADKLDTLAGLFGIGQIPTGD
KDPFALRRHALGVLRMLIEKDLPLSLDDLISIAVAEEQKIDGVKDASRELKDFFYDRLRV
MLKEEGAQALEVEAVLSVEPKYLREISARLKALQAFRKLEEAASLSAANKRIENILKKSK
DSIPESVDENLLEAQEEKDLYKALVEVNKDLEGKFEKGEYEAILLDLAPLKAPVDAFFDK
VMVNVDDEAVRRNRLALLKELHRSMNQVAKLSCLAS
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgaactccttattagtagaaatccaaacagaggagctccctccgaaggctctgaaaaaa
ttatcagatgctttttctcaggaagtctttactcaattgaagaaagcagactttttgctg
ccggactccaagatgaaagcctttggcgctccgcgtcgaattgccgtttacattactgac
gttttggcggattctcccgataaaccattcagccagagactggttccaagcaagattggt
atcggtgcagacggaaagcctactgcggctctgattaagaaattagcagctctcggtgta
caggctgacgtctctgaacttaaggtcgtcaatgacggcaaacaagaccagctttactat
gagggtgtgaagaaaggcgagagcttggaaaaaggcctccaaaacgctctcgactatgcg
gtaactcaccttccgattccaaagatcatgagctatcagctggctaatggagagaccgtt
gaatttgttcgtccggtaaagcatttgcttgctctttacggcgataaagtattgaatgtt
tctttgtttggattgaaagccggaaaccagacggcaggtcatcgcttccacaccaaagat
ttgttgacaattaactctgcggacacttatgaaacccagcttgaagagcagggcaaggtg
attccttcctttgaaaagcggcaagacaaaatggttgcggctttaaagagcgaagcggca
aatctgaatgcacaaatcatcatgccggaagacttggtcaatgaagtcgcttccttgact
gaatggcccgtcgtttatgtctcttcatttgatgaagatttcttgaaagttccggaagaa
tgtttgattctgacaatgcagcaaaaccaaaaatattttgccttgcgtgatcagaacggc
aaacttatcaataaattcttagtagtttctcagatcaatgccaaagacggcggcgctgcg
atccagtccggtaatgcgagagttgtcagagccagacttgcagatgctaagttcttcttt
gaacaggatcagctcgaacgtttggattctagagttcccggcttggaacacgttgtttat
cacaacaaactgggtaaccagcttcagcgcagtgaaagaattcaaaacatcgctgaaaaa
gttgctgagaagctcggcgcaaatcccgaacttgcaaaacgtggcgccaaattggctaag
gccgatttgcgtacattgatggtcggtgagttccctgagctccagggtatcatgggagaa
tactacgctctgcatgacaaagaagatccgatcgtagccgtttccattaaagaacactac
tatccgagatatgccggcggtgaattgccgagcactcccgaaagcctttccgtggcattg
gcagacaagcttgacacattagccggtctattcggtatcggtcagattccaaccggagat
aaagatccatttgcattgagacgccatgctttaggtgttttgaggatgttgattgaaaaa
gatcttccgctaagcttggatgatttgatttctattgctgtggctgaagagcagaagatt
gacggcgttaaagatgcttcccgcgagctcaaagacttcttctatgaccgccttagagtc
atgctcaaagaagagggtgcacaagctcttgaagtggaagccgtgctttccgtagaaccg
aagtacctgcgtgaaatctctgcacgtcttaaagcgttgcaagcctttagaaaactcgaa
gaggcagcaagcttaagtgccgcaaacaagagaatcgaaaatatcttgaagaagagcaaa
gacagcattcctgagagtgttgacgaaaaccttcttgaagctcaagaagaaaaagacctt
tataaggctttggttgaagttaataaagatcttgaaggtaagtttgaaaaaggtgagtat
gaggctattctccttgatctggctcccctcaaggctccggttgatgccttcttcgacaag
gtaatggtcaatgtggatgatgaagccgtaagacgcaatcgtcttgctttgctcaaagag
ctgcatcgttcaatgaaccaagtcgctaagctctcctgcttggcgtcctaa

DBGET integrated database retrieval system