KEGG   Burkholderiales bacterium YL45: A4V04_09780Help
Entry
A4V04_09780       CDS       T04607                                 

Definition
(GenBank) glutaminyl-tRNA synthase (glutamine-hydrolyzing) subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
bbay  Burkholderiales bacterium YL45
Pathway
bbay00970  Aminoacyl-tRNA biosynthesis
bbay01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbay00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A4V04_09780
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bbay03029]
    A4V04_09780
Enzymes [BR:bbay01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     A4V04_09780
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     A4V04_09780
Mitochondrial biogenesis [BR:bbay03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A4V04_09780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ANU66678
UniProt: A0A1C7HIX9
Position
2187711..2189159
Genome map
AA seq 482 aa AA seqDB search
MEWEVVIGLETHVQLSTKSKIFSGASAAFGAEPNTHACPVDLALPGCLPVLNEGAVERAI
KFGLAIGAKVANKSVFARKNYFYPDLPKGYQISQFEHPVVIGGSLTFPVENADGTSYTKT
VNLTRAHLEEDAGKSVHGVVHGKTGIDLNRAGTPLLEIVTEPEMRSAAEAVGYAKALHDL
VVWIGISDGDMQKGNFRCDANVSIRPKGQKEFGTRTEIKNLNSFKFLQAAIEYEVRRQIE
VITEGGKVVQATRLYDPDRDETREMRSKEDSMDYRYFPDPDLLPLIISDEWIEETKKGMP
ELPHAMRERLQKEMDLSEADTQQLTSSRELAVYFETTANAVKDKKAAVNWIRGEVLSQLN
ATETDISECPVSALQLAAIINKMTDGTINQKGARTIFTAIWEKKGDDIDALIESLGLKQI
SDTSAIEAIVDNVLAANEKMVQEYRSGKEKAFNALVGQTMRATKGKANPAQVNAILKKKL
QA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggaatgggaagttgttatcggacttgagacacacgtccagttatctacaaaaagcaag
attttctcaggtgcttctgcggccttcggtgctgaaccgaatactcacgcctgtccggtg
gatttagctcttccaggttgcctgccggttttaaacgaaggtgccgttgaaagagctatc
aaattcggtcttgctatcggcgcaaaagttgccaataagagcgttttcgcccgtaagaat
tacttttatcctgacctgccaaaaggctatcagatcagccaatttgaacacccggtggtc
atcggcggcagcctgactttcccagttgagaatgcggacgggacttcttataccaagaca
gtgaacctcacgcgtgcccacttggaagaagatgcaggcaagagcgtacacggtgtcgtc
cacggcaaaaccggcattgaccttaaccgtgcgggcacaccgcttctggaaatcgttacc
gaaccggaaatgagaagtgctgctgaagccgtaggatatgctaaagctcttcacgactta
gtcgtttggattggaataagcgacggcgatatgcagaaaggaaatttccgctgcgatgct
aacgtttctattcgcccgaaaggtcagaaagagttcggtacccgcacagaaattaaaaac
cttaatagctttaagttccttcaggcagctatcgaatatgaagtcagaagacaaatcgaa
gtgattactgaaggcggtaaagttgttcaggctacgcgcctctacgatccggacagagat
gaaacccgagaaatgagaagtaaagaagattctatggattaccgctatttcccggatcct
gatcttcttccgctgattatctccgacgaatggatcgaagaaactaagaaaggcatgccg
gaattgccgcacgctatgcgtgaaagacttcagaaagaaatggatctttccgaagcggat
actcagcagctgacttcttccagagaactcgcagtttattttgaaacgacagcaaatgcc
gttaaagataagaaagctgcagttaactggattagaggggaagttctttctcagctcaac
gctactgaaacagacatttctgaatgccccgtttctgcgcttcaattagccgccattatc
aacaagatgactgacggcaccatcaaccagaaaggcgcccgtacgatctttaccgctatc
tgggaaaagaaaggcgatgatattgatgcgctaattgaaagtctcggcctcaagcagatt
tccgacactagcgctattgaagcgattgttgacaacgtcttagccgctaatgagaaaatg
gttcaagaataccgttcaggcaaagaaaaagccttcaacgcccttgttggccaaaccatg
agagcaaccaaaggcaaagccaaccctgcacaggttaatgccattctgaagaagaaactg
caggcttaa

DBGET integrated database retrieval system