KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00131Help
Entry
BIF_00131         CDS       T01840                                 

Definition
(GenBank) Peptidase family M20A protein
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADC85727
UniProt: D3R4Q3
Position
1467054..1468475
Genome map
AA seq 473 aa AA seqDB search
MALRNRISHNLESSERTDMILTADQIRARVDADWPQILGVVEDRIALRPISAHGINGEHM
RKSAEYVANKLREVGVDAKAVQARDKDGNPSAWEVIGSLEVNPNAPTVLLYAHHDVQPVP
DEKEWDTAPFEATLKGDRLYGRGACDDAGGIAIHYGALRALGDQLGVNIKVFIEGEEEMG
SASFIPFIEAHHDEFDSDVIIVADSGNWAPDVPSLTTSLRGNATCDVHVKVLGHPVHSGQ
YGGPVLDANTLASMLIAKMYDEKGELAIPGLMEGEPIGGLQRDLDEADMRAAAGVVDSFT
LVGTGSLASRLWTKPSATVIGFDAHPVKDSFNVISPETTFRVSLRVAPQQDPHVAMDAMV
DFFEKNAPFGAEVHVEPLEAGMGWAMNPDCEATQDALTSLKEAFGIDPVNKGEGGSIPFI
PELQKIFPDAQVLVTGPEDPISNAHSPNESVSVSGLRKDVVAEALLLDKLGRA
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgcggaaccggatttcacacaatttggaatcctcggaaaggacggacatgatt
ttgacagcagatcagattcgcgcacgcgtggacgccgattggccgcagattctgggcgtg
gtggaggaccgcatcgcattgcgtcccatctccgcgcatggcatcaatggggagcatatg
cgcaaatcggcggaatatgtggcgaacaagcttcgcgaggtgggcgtggacgccaaggct
gtgcaggcgcgtgacaaggacggcaatccgagcgcatgggaggtgatcggctctctggaa
gtcaatccgaacgccccgaccgtgctgttgtacgcccaccatgacgtgcagcctgtgccc
gacgagaaggaatgggataccgcaccctttgaggccacattgaagggtgacaggctttat
ggccgcggcgcctgcgatgacgctggtggcatcgcgatccactacggggcgctcagggct
ctgggcgaccagcttggcgtgaacatcaaggtgttcatcgaaggtgaggaggagatgggt
tcggcgagtttcatcccgttcatcgaagcacatcacgacgaattcgactcagatgtgatc
atcgtcgccgattctggcaactgggcgccggatgtgccgtcgctcaccacgagcttgcgt
ggcaacgccacctgcgacgtgcatgtaaaggtgctcgggcatccggtgcattcgggacag
tacggaggcccggtgctcgacgcgaacacactggcctcgatgctcatcgcgaagatgtat
gacgagaagggcgaactggcaatcccggggcttatggagggcgagccgatcggcggcctg
cagcgcgatctggatgaggccgacatgcgtgcggccgccggcgtggtcgactcgttcacg
ttggtgggcaccggttcgctggcgtcacggttgtggacgaagccgagcgccacggtgatc
ggcttcgacgcccaccccgtcaaggactcattcaatgtgatcagccccgaaaccacattc
cgggtgagcctgcgcgtggcgccgcaacaggacccgcacgtggccatggacgcgatggtg
gacttcttcgagaagaacgcgcccttcggcgccgaggtgcacgtcgaaccgttggaagcc
ggtatgggctgggccatgaacccagactgcgaggccacgcaggacgcgctcacatcgctc
aaggaggctttcggcatcgacccggtgaacaagggggagggtggctccatcccgttcatt
cccgaactgcagaagattttccccgacgcgcaggtgttggtcaccggcccggaggacccg
atttcgaacgcgcacagccccaacgaatccgtgagcgtgtcagggttgaggaaggacgtc
gttgccgaggcgctgctccttgataaactgggcagagcataa

DBGET integrated database retrieval system