KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00179Help
Entry
BIF_00179         CDS       T01840                                 

Definition
(GenBank) NAD-dependent DNA ligase
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
bbb03030  DNA replication
bbb03410  Base excision repair
bbb03420  Nucleotide excision repair
bbb03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bbb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BIF_00179
   03410 Base excision repair
    BIF_00179
   03420 Nucleotide excision repair
    BIF_00179
   03430 Mismatch repair
    BIF_00179
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bbb03032]
    BIF_00179
   03400 DNA repair and recombination proteins [BR:bbb03400]
    BIF_00179
Enzymes [BR:bbb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     BIF_00179
DNA replication proteins [BR:bbb03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     BIF_00179
DNA repair and recombination proteins [BR:bbb03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     BIF_00179
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     BIF_00179
   MMR (mismatch exicision repair)
    DNA ligase
     BIF_00179
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BIF_00179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 BRCT HHH_5 DNA_ligase_ZBD PTCB-BRCT HHH
Motif
Other DBs
NCBI-ProteinID: ADC85720
UniProt: D3R4P6
Position
1457279..1459948
Genome map
AA seq 889 aa AA seqDB search
MRRCVGLTNGPRPWRFGLGRIWRNPVMEDALIADEQLDRYPIGSDPWIDSLRDIDSDAME
LDDLDVSKLNVEQAVRLWSRLSAWVEGDQVAYYVKDAPLSSDAAYDARMNCLKRLESEFP
QLDTPQSPTHRVGGTFSNDFTAVRHPSQMMSLDDVFSFEELRAWYDGVRKDLEWPEDKLL
PMTCEVKIDGLALNLIYRNGVLTQGLTRGDGVTGEDITMNVRTIHSIPTNLDGPEGDIPD
MVEIRGEVFMRWDDFHKLNEANEDAGRPPFANPRNAAAGSLRQKDPRITAQRHLSFYAHG
IGELVWGSGKPVDVADEVRNQSDAYTMYRKWGVPISPHNREVTDFDQILDMIEYYGEHRG
DIEHALDGIVVKVDDLALQRRLGSTSRAPRWAIAYKYPPEEVNTKLLNIVVQVGRTGRVT
PVAILNPVYVAGSTVSRTTLHNAYEVKRKGILIGDTVVVRKAGDVIPELVGPVIAKREGH
EQDLREFVMPTRCPSCDTVLRYEKEGDKDLRCPNSESCPAQLAERVINLAARKAFDIEHL
GDQSAVALTNPEDNRPDSVEAYAPGVREIVVEPGEEPAPYLAPSGLELPPIQEPVLTSEA
NLFDLEASDLRDVYVWREAQIIEVRRHVDSHGKERKVRHRLGGSGLWHREPAFWSGVKDA
PLKKDANRKTVKDSEGNPEYEVKPDAVIVGHGRNGRPRIEEPTENTRKMLDEIEKAKHTD
LSRVLVALSIRHVGPPTAFTLAKHFKTLDALADASAEELEQIDGIGAEIADSIATFFEEA
RMPGNWRGRVLEAWKAAGVGMSTHDEGLPQTLEGKSVVVTGTLEHFSRESAKEAIERRGG
KASGSVSRKTDWVVVGANPGSKATKAEELGIPIIDEQQFDTLLATGDVQ
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtagatgcgtaggattgaccaatgggccaagaccgtggcgtttcggattgggtagg
atttggaggaatccggttatggaagatgcattgattgcagacgagcagctcgacaggtat
ccgattggttcggatccgtggattgactcattgcgtgacatcgacagtgatgcgatggaa
cttgatgatctcgacgtgtcgaagctcaatgtagagcaggcggtgcggctgtggtcacgt
ctgagtgcttgggtggagggcgatcaggtggcctattacgtcaaggacgccccgctttcc
tccgatgcagcgtacgatgcgcgcatgaattgcctcaaacgactggagtcggagttcccc
cagcttgacacgcctcagtcaccgacccatcgggtaggtggcacattctcgaacgacttc
acggcggtgcggcacccctcccagatgatgagcctcgatgatgtgttctccttcgaggaa
ctgcgtgcctggtacgatggcgtgcgcaaggacctcgaatggccggaagacaagctgttg
cccatgacctgcgaggtgaagatagacggtctggctctgaatctcatctaccgcaacgga
gttctgacgcagggactcacccgtggtgatggggtcactggcgaagacatcacgatgaat
gtgcgcacgatacactccatccccaccaatctggatggcccggagggcgatattcccgat
atggtggagattcgcggcgaggtgttcatgcggtgggatgattttcacaagctcaacgag
gcgaacgaagatgcgggcagaccaccgttcgccaatccacgcaatgcggccgcgggatcg
ctacgccagaaggatccgcgcatcaccgcgcagcggcatctgagtttctatgcacatggc
atcggcgaactggtatgggggtcgggcaagccggtggatgtggccgacgaggtgaggaac
cagtcggatgcctacacgatgtaccgcaaatggggggtgccgatttcgccccataaccgc
gaggtcaccgacttcgaccagattctcgacatgatcgaatactacggcgagcaccggggt
gacatcgagcatgcgctcgacggcattgtggtcaaagtggacgacctcgcgttgcaacgc
agactgggcagcacctcacgcgcgccgcgttgggccatcgcctacaaatacccgcccgag
gaggtcaacaccaagctcctcaatattgtggtgcaggtcgggcgcacgggcagagtcaca
ccggtggccatactgaacccggtgtatgtggccggatccacggtgtcgcgcaccacgctg
cacaatgcatacgaggtcaaacgcaaaggcattctcatcggcgatacggtggtagtgcgc
aaggccggcgatgtgatccccgaactggtcggcccagtaatcgccaaacgcgaagggcat
gaacaggacctacgcgagttcgtcatgcctacacgatgcccatcctgtgacaccgtgttg
cggtatgagaaggagggagacaaggacctgcgatgcccgaattcggaaagctgcccggcc
cagctcgccgaacgtgtgatcaatctggcggcccgcaaggcattcgacattgagcatctg
ggtgaccaaagcgcggtggcgctgacgaaccccgaagacaacaggccggactcggtggaa
gcctacgcccccggcgtgcgtgagatcgtggtggaaccaggcgaggagccggcaccgtat
ctggctccgagcgggctggaacttccgcccatccaggagcccgtactcaccagtgaagcg
aatttgttcgacctcgaagcaagcgacctccgggatgtctatgtgtggcgtgaagcgcag
atcatcgaagtgcgcaggcacgtggattcgcatggcaaggagaggaaggtgcgccatcgt
ctcggcggttccggcctgtggcatagggagccggctttctggtccggggtcaaggatgcc
ccgctgaagaaggacgcgaatcgcaagacggtgaaggactccgaaggcaaccccgaatac
gaggtcaaaccggatgccgtgattgtgggccatggcaggaatgggcggccgcgcatcgag
gaacccaccgagaacaccaggaagatgctcgatgagatcgagaaagccaagcataccgat
ctgagccgcgtcctcgtagcgctctccattcgccatgtgggcccaccgaccgcattcacg
ctggccaagcactttaagacactcgatgcgctggccgacgccagtgccgaggaactcgaa
cagatcgacggcataggcgcggagatcgccgattccattgcgacattcttcgaggaggct
cgcatgccgggcaattggcgcggccgtgtgctggaggcgtggaaagccgccggtgtgggc
atgagcacgcatgacgagggtcttcctcagacgttggaaggcaagagcgtggtggtcacc
ggcacccttgagcatttctcccgcgaatcggctaaggaggccatcgaacgccgtggcggc
aaggcctccggatcggtgagcaggaagacggattgggtggtcgtcggagccaatcccggt
tcgaaggccacgaaggccgaggaactgggcatcccgatcatcgacgagcaacagttcgac
actttgctcgccaccggcgacgtgcaatga

DBGET integrated database retrieval system