KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00231Help
Entry
BIF_00231         CDS       T01840                                 

Definition
(GenBank) TenA
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
bbb00730  Thiamine metabolism
bbb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BIF_00231
Enzymes [BR:bbb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     BIF_00231
Transcription factors [BR:bbb03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BIF_00231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: ADC85710
UniProt: D3R4N6
Position
1442704..1443528
Genome map
AA seq 274 aa AA seqDB search
MRGDSDELRTRQRDPLNLLANTYVGRHHMAKSMPTTITRTDLPPFASRMRQAADPVWEEG
YRQPFIQELGAGTLDRSKFAFYLMQDELYLGAYAKVHALAVTKTDDREVMAWMASVQDAI
LHVETSLHRDYLASFGLTEEKVLHGQQSAFARAYTTNMLTTAYSGDLLDILVSVLPCAWV
YADYGERLARDFAQGLEHNPCRQWIDMYKTDEFWQSSVWLLAQIERRVAGVGEERRRGLV
DSFVRGVEYEYMFWASAYERQMTWKPQWEGLTSR
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcggggggactcagacgagttgagaacgcgacagcgtgaccctttgaacctgttggct
aacacctacgtagggagacatcatatggcgaaatccatgccgaccaccatcaccagaacc
gacctgccaccgttcgcgtcgcgcatgcgccaggccgccgatccggtatgggaagagggc
tacaggcagccattcatacaggaactcggcgctggaacccttgaccgttcgaagttcgca
ttctacctgatgcaggacgagctctacctcggcgcctatgcgaaggtgcatgcgctcgcc
gtgacgaagaccgacgaccgtgaggtgatggcatggatggcgagtgttcaggacgcgatc
ctgcatgtggagacctcactgcatcgcgattatctggcatcattcggcctgaccgaggag
aaggtgctgcacggccagcagtccgcattcgcgcgcgcctacacgacgaacatgctcacc
accgcgtattcgggcgatctgctcgacatcctggtgtccgtgctgccctgcgcgtgggtg
tacgccgactatggcgagcgactggcacgtgatttcgcacagggactcgagcacaatcca
tgccggcagtggatcgacatgtacaagaccgacgagttctggcagagctccgtatggctg
ctcgcgcagatcgaacgccgcgttgccggcgtgggcgaggagcgccggcgtggactggtg
gattcgttcgtgcgtggtgtcgaatacgagtacatgttctgggcgagcgcctatgagcgc
cagatgacctggaaaccgcagtgggagggcctcacctcacgctga

DBGET integrated database retrieval system