KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00367Help
Entry
BIF_00367         CDS       T01840                                 

Definition
(GenBank) Phosphoribosylglycinamide formyltransferase
  KO
K08289  phosphoribosylglycinamide formyltransferase 2 [EC:2.1.2.2]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
bbb00230  Purine metabolism
bbb00670  One carbon pool by folate
bbb01100  Metabolic pathways
bbb01110  Biosynthesis of secondary metabolites
bbb01130  Biosynthesis of antibiotics
Module
bbb_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bbb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BIF_00367
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BIF_00367
Enzymes [BR:bbb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     BIF_00367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp Dala_Dala_lig_C CPSase_L_D2 ATPgrasp_Ter GARS_A ATP-grasp_3 ATP-grasp_5 ATP-grasp_4 Epimerase RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: ADC85638
UniProt: D3R4G4
Position
complement(1357445..1358701)
Genome map
AA seq 418 aa AA seqDB search
MTTDSMILGTPFGEHPTRILMLGSGELGKEVTISLMRLGAWVCAADSYNGAPAAQVAHEA
RVLDMANADALRNVIGDVKPDIVIPEIEAIATDVLFEAEQAGIRVVPSAAIASICMDRER
LRQLAADELGLPTTKFEFAGSLQELKEAATRIGFPCVVKPVMSSSGHGQSVVRSADKIED
AWNEAQTGRRAHGEGDVSRVIIEQLVDLDYELTMLTVSSSAGIVVCEPIGQRQESGDYRD
SWQPAAVEPDHRQEVKRIATQAVQGLIAHAGTDTAWGVFGVELFVLKDGTVLFNEVSPRP
HDTGMVTMISQYLSEFDLHARAVLGIPVSKAHIGLDLPKYYGAASHAIVVEGNGEVEFSN
LQTALATPGTDLRIFSKPRVEGHRRMGVTLAIGSDIDEARIKANECAQNLRIVVNPAK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgactacagattccatgattctcggcacaccattcggtgaacatcccacccgcattctc
atgctcggttcgggcgaactcggcaaggaggtgacgatttcactcatgcggctcggcgca
tgggtgtgcgccgctgattcctacaacggcgcaccggccgcacaggtcgcccacgaggca
cgggtgctcgacatggcgaacgccgatgcattacgcaatgtgataggcgacgtcaaaccc
gacatcgtcattcctgaaatcgaggccatagccaccgacgtgctgttcgaagcggagcag
gccggcatccgcgtggtgccgagcgctgccatcgcctcaatttgcatggatcgtgagcgt
cttcgccagctcgccgccgacgagctgggactgcccaccacgaaattcgaattcgcggga
agcctgcaggaactcaaagaggcggccactcgcatcggcttcccctgcgtggtcaagccg
gtcatgagctcctcgggccacggccagtcggtggtgcgatccgccgacaagatcgaggac
gcatggaatgaggcgcaaaccggtcgccgtgcgcatggggagggcgatgtctcccgcgtg
atcatcgaacagctcgtcgaccttgattacgaactcaccatgctcaccgtgagctcatcg
gcaggcattgtggtgtgcgaaccgattggccagcggcaggaaagcggcgattaccgtgat
tcctggcagcctgcggccgtcgagcccgatcatcggcaggaggtcaaacgcattgccacg
caggccgtgcagggtctcatcgcccatgccggcaccgacaccgcatggggcgtgttcggc
gtcgaattgttcgtgctcaaagacggcaccgtgctcttcaacgaggtctccccccgcccg
cacgatacgggcatggtcaccatgatcagccagtatttgagcgagttcgacctgcatgcg
cgcgccgtgctcggaatcccggtctccaaggcgcatatcggactcgacctgccgaagtat
tacggcgcggcgagccatgcgatcgtcgtcgagggcaacggcgaagtcgaattctcgaac
ctccagaccgcactcgccacaccgggcaccgatttgcgcatcttctcgaagccgcgggtg
gagggccatcgccgcatgggcgtgacgctcgccatcggctccgacatcgacgaggcgcgc
atcaaggcgaacgagtgcgcgcagaatctgcgcatagtggtgaatccggcgaagtag

DBGET integrated database retrieval system