KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00385Help
Entry
BIF_00385         CDS       T01840                                 

Definition
(GenBank) Long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
bbb00061  Fatty acid biosynthesis
bbb00071  Fatty acid degradation
bbb01100  Metabolic pathways
bbb01212  Fatty acid metabolism
bbb02024  Quorum sensing
Module
bbb_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bbb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BIF_00385
   00071 Fatty acid degradation
    BIF_00385
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BIF_00385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bbb01004]
    BIF_00385
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbb04147]
    BIF_00385
Enzymes [BR:bbb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     BIF_00385
Lipid biosynthesis proteins [BR:bbb01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   BIF_00385
Exosome [BR:bbb04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   BIF_00385
  Exosomal proteins of breast cancer cells
   BIF_00385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADC85703
UniProt: D3R4M9
Position
complement(1435771..1437660)
Genome map
AA seq 629 aa AA seqDB search
MTSENHSNAQQPAPSADEVTDAGIVKEYTTPLKHEIDPDINLFDFLEGRAQRNPDGSMVS
YKDANGIWQTFSATEFRDKVVAIARGLIGWGARAGESIAIIAHTRWEWVALDMAIMSIGC
VTVPVYETNSPAQIRMVFNDAEVVLAFAEDDAQRDKLESIANDTPSMRGSFVIDSAAIDA
IIAFGANVTEEQFLERKAAVHGDTLATIIYTSGSTGTPKGVEISHGNMAAECMDALQYMP
RAIDIPDRRLLLFLPLSHVFARFMATVAFAGTLTLGLTSNMKTIIKDFEDFGPTLLLAVP
RVFEKVYNAASQRAGTGFAGRMFARGVRVAREWSKAKQSGNGIPAGLRMRHAFYDAVVYK
KIRTVFGRNADFAITGGAPMDSDLAHFYNGIGMPLLEGYGMTETSGPVCVSLPENNHIGT
IGQPLCGTTAGIAEDGELCFKGRDICMGYHNQPEVTKQQIVDGWLHTGDLGDIDDEGFIH
LTGRKKDLIITAGGKNVSPGHLETTVMTSPVVAQCLVIGDRKPFVAALVTLDLEDANAWL
TSQGAKPAADLEELSKNPIVHTEVERIVNKANEGVSRAESIRKFEILPDEFTSENGMLTP
SLKTRRKQIIDHYRKLIDTVIYVPRKKAS
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtgaaaatcattccaacgcgcagcagcccgcaccaagcgcagacgaagtgacc
gacgccggcatcgtcaaggagtacaccaccccactcaagcacgagattgatccggacatc
aatctgttcgactttctggaagggcgcgcgcagcgcaatcccgacggctccatggtgagc
tacaaagacgccaacggcatctggcagaccttctcggctactgagttccgagacaaggtg
gtggccatcgccaggggacttatcggatggggcgcacgcgcaggcgaatccatcgcgatc
atcgcgcacacccgttgggaatgggtggcccttgacatggccatcatgtccatcggctgt
gtcaccgtgccggtgtatgagaccaactcacctgcgcaaatccgcatggtgttcaacgac
gccgaagtggtgctcgccttcgccgaggacgacgcgcaacgcgacaagctcgaatccatc
gccaacgacaccccatcgatgcgtggttcattcgtcatagattcggccgccattgacgca
atcatcgccttcggggccaacgtgaccgaggagcagttcctcgagcgcaaagccgccgtc
catggcgacacgttggccacaatcatctacacctccggatccactggcacccccaaaggc
gtggaaatcagccacgggaacatggccgccgaatgcatggacgccctacagtacatgcct
cgcgcaatagacatccccgaccgccgcttgctgctgttcctcccgctttcccatgtgttc
gcacgattcatggccacggtggcctttgccggcacactcactctcggcctcaccagcaat
atgaagacgatcatcaaggacttcgaggacttcggtcccactctgctgctcgccgtcccg
cgcgtattcgaaaaggtgtacaacgccgcctcccaacgtgcaggcactggtttcgccggc
cgcatgttcgcccgcggcgtacgcgtggcacgcgaatggagcaaggccaagcaatccggc
aacggaattcccgcaggcttgcgcatgcgccatgcgttctatgacgccgttgtctacaag
aagattcgcacggtgttcggccgcaatgccgacttcgccatcaccggcggcgcgccgatg
gactcggatctggcccatttctacaatggcataggcatgccgctgctcgaaggctatggc
atgacggagacctcgggacccgtttgtgtctcattgcctgagaacaaccacatcggcacc
atcggtcagcctctgtgcggcacgaccgcaggcattgccgaagacggtgaactgtgcttc
aaggggcgcgacatctgcatgggatatcacaaccagccggaggtgaccaagcagcagatt
gtggatggctggctgcataccggcgatctgggtgacatcgacgatgagggtttcatccac
ctcaccggccgtaagaaagacctcatcatcaccgccggcggcaagaacgtctcccctggg
catttggaaaccactgtgatgacttcgccggtcgtagcccaatgcctggtgatcggtgac
cgcaagccgttcgtggcggctctcgtcaccctcgacctcgaagatgcgaatgcatggttg
acctcgcagggagccaaaccggcagccgatctggaagagctttcaaagaacccaatcgtg
cacaccgaagtggagcgcattgtgaacaaggcgaacgaaggggtctcccgggctgaatcg
attcgcaagttcgaaatactgcccgacgaattcacttcggaaaacggcatgctcacacca
agtctcaagacgcggcgcaagcagatcatcgaccattaccgcaaactcatcgacacggtc
atctacgtgccacgcaaaaaagccagctga

DBGET integrated database retrieval system