KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00467Help
Entry
BIF_00467         CDS       T01840                                 

Definition
(GenBank) Dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
bbb00290  Valine, leucine and isoleucine biosynthesis
bbb00770  Pantothenate and CoA biosynthesis
bbb01100  Metabolic pathways
bbb01110  Biosynthesis of secondary metabolites
bbb01130  Biosynthesis of antibiotics
bbb01210  2-Oxocarboxylic acid metabolism
bbb01230  Biosynthesis of amino acids
Module
bbb_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bbb_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bbb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BIF_00467
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BIF_00467
Enzymes [BR:bbb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     BIF_00467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: ADC85654
UniProt: D3R4I0
Position
complement(1376109..1377974)
Genome map
AA seq 621 aa AA seqDB search
MLMEMRSAKIMNGRMFAGARALYRAAGVDSKDFGKPIVAIANSFDEFVPGHVHLNKVGRL
VSEAVKKAGGIPREFNTMAVDDGIAMGHTGMLYSLPSREIIADTVEYQVNAHCADALICI
SNCDKITPGMLMAALRLNIPTVFVSGGPMEAGTTVLPDGTVKENTDLIDVMYASADDSMS
DDDLLAFERTVCPTCGSCAGMFTANSMNCLTEAIGLALPGNGTVLASHGYRKQLFERAAQ
QVVKIANQYYQHDDESVLPRSIATKHAFENAMTMDVAMGGSTNTVLHILAMAQSADVDFT
LNDIERISHTVPCICKASPSGEWEISDVHRAGGITGILGELDRAGKLHRDVHSIDYPSLE
AKLDEWDIMRDSCTEYAKDFYRAAPGHIVSPEPWTHETKFDSLDTDRVNGAIHDIDHPAV
TEGGLAVLRGNLAPDGAVVKTAGVPKEIWKFRGPALVVESQEQAVEVILNDTLKPGQALI
IRYEGPKGGPGMQEMLYPTSFVKGKGIGKDVALITDGRYSGGSSGLSIGHVAPEAASGGN
IALVENGDIITIDIPNRTINVELTDEELAERRAKLEAGDGYVAHRDRKVSQALKAFAAFA
RSADKGATRDPELIDRLSGLA
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgcttatggaaatgcgatctgcaaaaatcatgaacggacgaatgttcgccggtgcccgc
gcgctctaccgtgcggccggcgttgacagcaaggatttcggcaagccgatcgtcgccatt
gccaactccttcgacgaattcgtccccgggcacgtacatctcaacaaagttgggcgtctc
gtctccgaggccgtgaagaaggccggcggcatcccgcgtgagttcaacacgatggccgtc
gacgacggcatcgccatggggcacaccggcatgctgtactccctgcctagccgcgagatc
atcgccgatacggtggaataccaggtgaacgcgcattgtgcggacgcgctgatctgcatc
tcgaactgcgacaagatcacaccgggcatgctcatggcggcattgcgtctcaacattccg
accgtgttcgtctccggcggccccatggaagccggcaccaccgtgctgccggacggcacc
gtgaaggagaacaccgatctcatcgacgtcatgtacgcctctgccgacgactccatgagc
gacgacgacctcctcgccttcgagcgcaccgtgtgcccgacatgcggctcatgcgccggc
atgttcaccgcgaactcgatgaactgcctcacggaggcgatcggccttgcactgcccggc
aacggcacggtgctcgcctcgcacggctaccgcaagcagctgttcgaacgggcggcacaa
caggtggtcaagatcgccaaccagtactaccagcatgacgacgaatccgtgctcccccgt
tcgatcgccacgaagcacgccttcgagaacgccatgacgatggatgtggcgatgggcggc
tcgacgaacaccgtgctgcacattctcgcgatggcacagtctgcggacgtcgacttcaca
ctcaatgacatcgaacgcatctcgcatactgtgccgtgcatctgcaaggcatcgccatcc
ggcgaatgggagatctccgacgtgcaccgagccggaggcatcaccggaatcctgggtgag
ctcgaccgtgccggcaagctccaccgcgatgtgcattcgatcgactacccctcgctcgag
gccaagctcgacgagtgggacatcatgcgcgactcctgcaccgaatacgccaaggacttc
tacagggcggctccgggccacatcgtctcccccgagccatggacccatgagacgaaattc
gattcgcttgacaccgaccgtgtgaacggcgcgatccacgacatcgaccatcccgccgtg
accgaaggcggtctcgccgtgttgcgcggcaacctcgccccggatggcgccgtggtgaag
accgcaggtgtgccgaaggagatctggaagttccgtggtcccgcgctcgtcgtcgaatcg
caggagcaggcggtcgaggtcattctcaacgacacgctgaaaccaggtcaggcactcatc
atccgttatgagggaccgaagggcggcccgggcatgcaggagatgctctacccgacctcg
ttcgtcaaaggcaagggcataggcaaggacgtcgcactgatcaccgacggccgctattcg
ggcggctcctcgggcctgtcgatcggccatgtggcgcctgaggcggcgagcggcggcaac
atcgcgctcgtcgagaacggcgacatcatcaccatcgacatcccgaaccgcacgatcaac
gtcgagctgaccgacgaggaactcgccgagcgccgtgccaaactcgaggccggcgatggc
tatgtcgcacaccgtgatcgcaaagtgagccaagcactcaaggccttcgccgccttcgcc
aggtcggccgacaagggcgccacccgcgaccccgagctcatcgaccgtctttcgggactg
gcctga

DBGET integrated database retrieval system