KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00504Help
Entry
BIF_00504         CDS       T01840                                 

Definition
(GenBank) ATP-dependent DNA helicase
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3516 DEAD Helicase_C ResIII
Motif
Other DBs
NCBI-ProteinID: ADC85700
UniProt: D3R4M6
Position
complement(1430030..1432618)
Genome map
AA seq 862 aa AA seqDB search
MAEADDERTALMRLVPSRGEDNRSLDADEIYERFFDWVVEERGIEPWPHQEEAVLDLLAG
DHVVLNTPTGSGKSLVALGMHFAALCTGRRSYYTAPIKALVSEKFFELVNVFGRENVGMI
TGDSHINAEAPIICCTAEILANQALREGRRADIGCVAMDEFHYYGDPERGWAWQVPLLTL
PQAQFLLMSATLGNVDTIADSLEDLTDTDVDIIAEARRPVPLSYRYTTDPLEKTVELAVQ
NGETPIYIVHFSQDAALDTAQSLSNTGVSTKEQREAIARAMKGTKFTTGFGKILQRLLRT
GVGIHHAGMLPRYRRLVEQLAQQGLLPVICGTDTLGVGINVPIHSVVLTQLTKFDGTHMR
KLRAREFHQIAGRAGRSGFDTEGLVIAEAPEYEIENARALAKAGGDPKKLRKIKRKKAPE
GFVTWNESTFAKLIGKEPETLIPHMKITHSMVLNEVAQGGDARKRIDRLIEDSAQTDEQK
NALRTRADEIFRTLIDTDVIEIEQEDGRDYYYTTVDLPQDFALDQPLSPFLIAALELLDP
ASPSYALDVISMAEATLEDPKQILRAQERQARDKAMEEMKADGVDYDERLDRLQDITYPK
PLNDLLTEAFDQYRKDVPWANDYWINPKSVVRDMVETASDFNGYIARYNAARSEGTLLRY
LSDAYRVLARTVPPEKRNEELDDIIAWLRVLVRSIDSSLVDEWENAGTQAQEAANLAAPN
VANAVVEDRRGLIVLIRNAMFRRVQLMDLDRPDELGALDKAWHYDVHTWEDVLDDFYDEH
EYVNTDAEARGGEYFVLDTRHEQDRHEWTVRQIIDDSDGDHDWAITGTVNLDATQESGEV
VFTDYSVRDVVNDNDAATVKAQ
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggcagatgacgaacggacggcattgatgagattggttccctcccgaggggag
gacaaccgatcgctggatgccgatgagatctatgagcgattcttcgactgggtggtcgag
gagcgtggcatagagccgtggccgcatcaggaggaggcggtgctcgacctgctggcgggg
gatcatgtggtgctcaacacacctaccggctcgggaaagtcactggtcgcgctgggcatg
catttcgcggcattgtgcaccgggcggcgctcatactacaccgcgccgatcaaggcactg
gtctccgagaagttcttcgagctggtcaacgtgttcggcagggagaatgtgggcatgatc
accggcgactcgcatatcaacgccgaagcgccgatcatctgctgcacggccgagattctc
gccaaccaagcgttacgggaggggcgtcgggctgacatcggctgcgtggccatggacgaa
ttccattactacggcgatcccgaacgcggctgggcatggcaggtgccgctgctcaccctc
ccccaggcccagttcctactcatgagcgcaacgttgggcaatgtggacacgattgcagat
tcgctcgaggacctcaccgacaccgacgtggacatcattgccgaagcacgccggcctgta
cccctcagctaccgatataccaccgatccacttgagaagacggtggaactggcggtgcag
aacggtgagacccccatttacatcgtgcatttctcgcaggatgccgcactcgacaccgcg
cagtcgctgtcgaacaccggggtttccaccaaggagcaacgcgaggcgattgccagggcg
atgaagggcacgaagttcacaacgggcttcggaaagatcctccaacggttgctccgcacc
ggcgtgggaatccaccatgcgggcatgctcccccgctaccgccgtctggtggagcaactc
gcccagcaggggctgctacccgtcatctgcggcaccgacacgcttggcgtgggcatcaat
gtgccaatccattcggtggttctgacgcagctgaccaaattcgatggcacccatatgcga
aaactgcgtgcacgtgagttccatcagatagccggacgcgcgggccgctcgggcttcgac
accgaaggactggtgatcgccgaagcccccgaatacgagatcgaaaacgcccgtgccctg
gcgaaggcaggcggtgatccgaagaaactcaggaagatcaagcgcaagaaagcaccggag
ggattcgtgacatggaatgagtccaccttcgccaagctaatcgggaaagaaccggaaacg
ctgatcccccatatgaagataacccattcgatggtgctcaatgaagtcgcccagggaggc
gatgccagaaaacgcatcgaccggctcatcgaagattccgcgcagaccgatgagcagaag
aacgcacttcgcacccgcgccgatgagatcttccgcacactcatcgacaccgatgtaatc
gaaatcgaacaggaagacggccgcgactactactacaccaccgtcgatcttccgcaggat
ttcgcgctcgaccagccgttaagcccattcctcatcgccgcccttgaattgctcgatccc
gcttccccgtcgtatgcactcgatgtgatctctatggccgaagccacgttggaagatcca
aagcagattctgcgcgcccaggagcggcaggctcgggacaaggcgatggaggagatgaag
gccgatggcgtcgattacgatgaacgtctcgaccgtctgcaagacatcacctatcccaaa
ccattgaatgacctgctcactgaagcattcgaccagtaccggaaagacgttccctgggcc
aacgactactggatcaatcccaagtccgtggtgcgcgacatggtcgagactgcatccgac
ttcaacggctacatcgcccggtacaacgcagcccgttcggaggggacgctgttgcgctat
ctgtctgatgcataccgtgtgctggccagaacggtacccccggagaaacgcaatgaggaa
ctcgacgacatcatcgcatggttgcgcgttctggtccgctccattgactccagcctcgtg
gacgaatgggaaaacgccggcacacaggcgcaggaggccgcgaacctcgccgcaccgaat
gtggccaacgccgtggtggaagatcgtcgcgggctcatcgtgctcatccgcaatgcgatg
ttccgccgtgtgcagctcatggacctcgaccggcctgatgagttgggtgcactcgacaag
gcatggcattacgatgtgcacacgtgggaggatgtgctcgatgacttctatgacgagcac
gagtacgtgaacacggatgccgaagcccgtggtggtgagtatttcgttctcgacactcgc
catgagcaggatcgccacgagtggacggtgcgccaaatcatcgatgattccgacggcgac
catgactgggcaatcaccggcactgtgaatctcgatgccacgcaggaaagcggagaagtg
gtgttcaccgactattcggtgcgtgacgtagtcaacgacaacgatgccgccaccgtaaaa
gcgcagtga

DBGET integrated database retrieval system