KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00625Help
Entry
BIF_00625         CDS       T01840                                 

Definition
(GenBank) Transporter
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2156
Motif
Other DBs
NCBI-ProteinID: ADC85619
UniProt: D3R4E5
Position
complement(1333161..1335929)
Genome map
AA seq 922 aa AA seqDB search
MSATDSNDGVASGQTQAAAKPPTSPKPPKAPKRYAAQPVSNQLLNDIRRWIHEQSFALWV
TFGFIMINVCWWAWYNIEHHKMPRHALTTSLHEFNVGHLIASLFLTGSVFQMIVDALLIL
LVLCLAEPYLGKSRTAAISLVSAASGTLVGLIICSAISAMLGERAEVLNISFTLSPVVLV
IGALMAATAFSYQLWRRRIRIIGYTAIMVVVLYGGNPGDYCVLFAAIIGQIIGRAIAGKP
IEAEQWHWQYSSSQEIRRIFGAIGVVLALGPMVATSSRSHAGPLVSVALVLSPESVNTGV
LAACMHGHVVDGCLQQYSLMRASQPGDVVRSVLPLLVMLALAWGMWLGRRTAAISSIVFY
AASAFFAISYYLLPYSLDDQLHITMGNIPRMILVNALIPLIYAIAVIIELPHFSIRTKPR
TLRRCVAAIVIAFVVCSAIYLLFACLRPQDFTPHPNVGMVLREWPARFLPIGYLTDSSIS
FIAVTPLASLVLQGVGIVFWIVLVVVSFAWLNASIDYDHKAHALAEELVEDGGESMSFMT
TWEGNEYWLSPSKRSAVAYRVLNHIALTTTGPFGDPDEWMSDMDEFARYCSDHSWSPVFY
AIHEEAKDHLQQLGWHSIVVGDEMLIDPQSWKTTGKKWQDIRTAINKAKREGIVDEMSTY
DEAPHEVQVQIEEISEQWSEGKALPEMKFTLGGVEELKDPRVQVLYAIDSDGIVQAVTSW
LPTFNNGRVIGWTLDFMRYRSGSYNGIMEFLIARMAQRMHDQGVADPSNQVQFVSLSAAP
LTGLKNFTDAKSDDSSNVDGTTMLQHSLALVADLLEPAYGFKSLYNFKKKFQPIERPVYI
SYSDSALLANLGIAIIRAYLPALTFRDALGMLSSFKPAKPKDDGKATGHGQPAGSPRDAA
HESEVHDAKGGKPVDDQAGEPR
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcaacggattcgaatgacggcgtcgccagcgggcagacgcaagcggcggcaaaa
ccgccgaccagccccaaacctcccaaagcgccgaagcggtatgcggcgcaaccggtgagc
aaccagctgctgaacgacatccggcgttggatccacgagcagagcttcgccctgtgggtc
accttcggcttcatcatgatcaatgtgtgctggtgggcatggtacaacatcgagcaccac
aagatgccacgccatgcgctcaccacgagtctgcacgagttcaatgtggggcatctcatc
gcctcgctgttcctcaccggttcggtgttccagatgatcgtggatgcgctgctgatcctg
ttggtgctgtgcttggcggaaccctatctcggcaagtcccgcacagccgccatcagtctg
gtgagcgccgcatccggcacactcgtaggcctgatcatctgttcggcgatcagcgcgatg
ctcggcgaacgtgcggaggtgctgaacatcagcttcacgctctcccccgtcgtgctggtg
atcggcgcgctcatggcggcgacggcgttctcataccaattgtggcgcagacgcatacgc
atcatcggctacacggccatcatggtcgtggtgctctacggcggcaatcccggcgattat
tgcgtgctgttcgccgcgatcatcgggcagatcataggccgtgcgattgccggcaagcca
atcgaagccgagcagtggcattggcagtacagttcgtcgcaggagattcgccgcatcttc
ggcgcgatcggcgtggtgctcgccttgggacccatggtggcgacttcgtcgcgatcccat
gccggccctctcgtgtcggtggcactggtgctcagccccgaatcggtgaacaccggggtg
ttggcggcctgcatgcacggccatgtggtcgacggctgcctccaacagtattcgctcatg
cgtgccagccaaccgggggacgtggtgcgatcggtgctgccgctgctggtgatgctcgcc
ctggcatggggcatgtggctgggacggcgcaccgccgcgatcagcagcatcgtgttctat
gcggcgagcgcgttcttcgccatctcctactacctgttgccgtattcgttggatgatcag
ctgcatatcaccatgggcaacataccgcgcatgattctcgtcaatgcgcttataccgctc
atatacgcgattgccgtgatcatagagctcccgcatttctccattcgcacgaaaccgcgg
acgcttcgccgctgtgtggctgccattgtgatcgccttcgtcgtatgttcggccatctac
ctgctgttcgcctgtttgcgacctcaggatttcacgccgcatccgaatgtgggcatggtg
ctacgcgagtggcctgcaaggttcctgccgatcgggtatctgacggattcgagcatctcg
ttcatcgccgtcaccccgttggcttcgcttgttctgcagggcgtgggcattgtgttctgg
atcgtgctcgtcgtggtctccttcgcgtggctcaacgcgtcaatcgactatgaccacaag
gcccatgcgctggccgaggaactggtggaagacggcggcgagtccatgagcttcatgacg
acgtgggagggcaacgaatactggctgtcgcccagcaaaaggtccgctgtcgcctaccgt
gtgctcaaccacatcgcattgaccaccaccggaccgttcggcgacccggatgaatggatg
agcgatatggacgagttcgcccgctactgctccgaccattcatggtccccggtgttctac
gccatccacgaggaggccaaggatcacctgcagcagctcggatggcactccattgtggtg
ggagacgagatgctcattgacccgcaaagctggaagaccaccggcaagaagtggcaggac
attcgcacggccatcaacaaagcgaagcgtgagggcattgtcgatgagatgagcacctac
gatgaggcgccccatgaggtgcaggtgcagatcgaggagatttccgagcagtggagcgaa
ggcaaggcgctgcctgagatgaagttcacgctcggcggcgtggaggagctcaaggacccg
cgcgttcaggtgctctatgccatagattccgacggcatagtgcaggcggtcaccagctgg
ctgcccacattcaacaacgggcgcgtgatcggctggacgctggacttcatgcgctaccgt
tccggaagctacaacggcatcatggagttcctcatcgcacgcatggcccagcgcatgcat
gaccagggtgtggccgatccgagcaaccaggtgcagttcgtgagcctgtcggcggcaccg
cttacgggactcaagaacttcaccgacgcgaagagcgacgacagctcgaatgtcgatggc
accacgatgctccagcattcgctcgcgcttgtggcggatctgctcgaaccggcctatggg
ttcaagtcgctctacaacttcaagaagaagttccagccgatcgagcgtccggtctacatc
agctactcggattccgcattgcttgccaatctgggcattgcaatcatccgcgcctacctg
cccgccctgacgttcagggatgccctgggcatgctttcgagcttcaaaccggccaagccg
aaggatgacgggaaggcaacgggccatgggcagcctgcaggcagcccacgcgatgctgca
cacgagtccgaggtacatgacgccaaaggtggcaagccggtggacgaccaagctggcgaa
ccacggtaa

DBGET integrated database retrieval system