KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00718Help
Entry
BIF_00718         CDS       T01840                                 

Definition
(GenBank) hypothetical protein
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AJAP1_PANP_C PetG
Motif
Other DBs
NCBI-ProteinID: ADC85688
UniProt: D3R4L4
Position
complement(1414153..1415175)
Genome map
AA seq 340 aa AA seqDB search
MSADDESADNVGETSAQMTAAPESVTQSTTDDQDEVHGTVVPPSFPPHHEETDPASDSED
TDAKQRPSKSARGGARRHLPMHITTIVLGIIVILIAGLYLYANGNISGTPRAAAMSDCRS
SVSHANSARSLLTTAVGDAKTYRASHVTDMSDEQLRNLTSYLDQSAQQPSVPSCSIIAND
GVLQTNAVNAKKLAHNATTLTRDLLLATTGVLPQELQGDEQTGDPSYSPSETQMPTESPQ
PPTSPSTDSSTHGTTSDDAKSHNDSGTANELASPSAQPSNTSRTSPEPSPSPSASMSTSS
EDAGTGKRKQKESGSSASSQSEGNGSNTTKSNGTKSGNVM
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggatgacgagtctgcagacaatgtcggcgaaacgagcgcgcagatgaccgca
gccccagagtcagtgacgcaatcgacaacggacgatcaggatgaagtgcatggcacggta
gtgccaccgtcattccccccgcatcatgaggagacggatccggcctcggatagcgaagat
accgatgccaagcagcgcccctcgaagagcgcccgcggcggagccagacggcatctgccc
atgcatatcaccacgatcgtgctcggcatcattgtgatcctaatcgccggattgtacctg
tatgccaatgggaacatatcgggaacgcctcgcgcggccgcaatgagcgattgccgatcc
agcgtctctcacgcgaattcggcgcgcagcctgctcaccaccgcagtgggcgatgcgaaa
acataccgggcatcgcatgtcacagacatgtccgatgagcaactgcgcaatttgacctcg
tatctcgaccaatccgcacaacagccgtcggtgccgtcatgctcaatcatcgccaacgat
ggcgttctgcaaaccaatgccgtcaatgccaagaagctcgcacacaacgccacaacgctg
acccgcgatctgctgctggcgacgaccggcgtgctcccccaggaactgcagggcgatgag
cagacgggtgacccttcatactcgccgtccgaaacacaaatgccaaccgaatcgccgcag
ccacccacctccccgagcaccgattccagcacccatggcacgacatcagatgatgcgaag
tcacacaacgacagcggcacagccaacgaactcgcatctccctcggcgcagccctccaac
acctccagaacctcgccggaacccagtccctcgccatccgccagcatgtcgacctcctcc
gaagatgcggggacaggcaagcgcaaacagaaggagtccggctcgtccgcatcctctcaa
tccgaaggaaacgggtcgaacacgacgaaatccaacgggacgaaatcgggcaatgtcatg
tga

DBGET integrated database retrieval system