KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00731Help
Entry
BIF_00731         CDS       T01840                                 

Definition
(GenBank) hypothetical protein
  KO
K07114  Ca-activated chloride channel homolog
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Brite
KEGG Orthology (KO) [BR:bbb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbb02000]
    BIF_00731
Transporters [BR:bbb02000]
 Other Transporters
  Pores ion channels [TC:1]
   BIF_00731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 VWA UDPG_MGDP_dh_N DUF5073 TusA ABC2_membrane_2
Motif
Other DBs
NCBI-ProteinID: ADC85673
UniProt: D3R4J9
Position
complement(1399626..1400696)
Genome map
AA seq 356 aa AA seqDB search
MVDSRCGDSACGLVGYGVEVEAMSTFGFAPALGWIGGSLVAAVMVACAVTCVVLHARRGA
DGTDETLWSCVRRVLACVIVALMAFTPSMVTKTTSRAISTTDVVIVSDITPSMGVQDARY
GSKSDLSRLEAAKSAIADIVRDYPNSSFSAVSVGASGAVDVPLTPDTRAITNWAQSLDTE
DSSSSSGSSLDVVIDPLLRALKSIRDAHPDDRIVLYIITDGEQTVRNTRRTFSSLRHYID
DACVIGVGSTTGGRIPSKTAGQWVTDPSTGQPGVSIMDEGQIRSLADELSGKVVITSAND
TVASAQIAQQAGSWREDDTQKERTRINPIVWPLAIALAALLAWELGTWIATSRRLL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggtggactctcgctgtggcgattctgcttgcgggctggttggttatggcgtggaggtt
gaagcgatgagtacgttcggctttgcaccggccctcggctggattggcggctcccttgtg
gctgcggtgatggtggcatgcgcggtgacgtgtgtcgtgctgcatgcacgtcgcggcgcc
gatggtaccgatgagacactctggtcgtgcgtaaggcgtgtgctggcatgcgtcatcgtg
gcgctcatggccttcacaccaagcatggtgaccaagaccaccagccgtgccatcagtacc
actgatgtggtcattgtctcggacatcacgccgtcgatgggtgtgcaggatgcccgctat
ggctccaagtccgacctttcccgcctcgaagcggcgaagtccgccattgcagacatcgtc
agggattacccgaattcgagtttctccgcagtatccgttggagcatcgggagcggtggat
gtgccgctgacgcccgacacccgtgccatcacgaattgggcgcagtcccttgataccgag
gattcctcgagttccagcggttcatcgcttgatgtggtgatcgatccgttgctgcgtgca
ctcaaatcgattcgcgacgcccacccggacgatcgcattgtgttgtacatcatcacggat
ggggaacagactgtgcggaacacacgccgcacattttcgtcgctgcgccactatattgac
gatgcctgcgtgatcggcgtcggctccaccaccggtggccggataccttcgaagaccgca
ggtcaatgggtcaccgatccctctacgggccagcccggcgtatcgatcatggatgaagga
cagattcggtcgctggccgacgagctcagtggcaaagtggtgatcacctcggcgaacgac
acggtggcgagcgcacagatcgcgcaacaggccgggagctggcgtgaagacgacacgcag
aaggagcgtacgcgcatcaatccgattgtctggccactggccattgcattggctgcgttg
ctggcatgggagctgggcacatggatcgccacttcgaggaggcttctatga

DBGET integrated database retrieval system