KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00732Help
Entry
BIF_00732         CDS       T01840                                 

Definition
(GenBank) Von Willebrand factor type A domain protein
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 VWA VWA_CoxE DUF4131 BatA Sec20 DUF2157 Neurensin Wzy_C DUF1772
Motif
Other DBs
NCBI-ProteinID: ADC85674
UniProt: D3R4K0
Position
complement(1400627..1401694)
Genome map
AA seq 355 aa AA seqDB search
MAMMLRWQWPWALVAALLIAALVCLTIVMVSSHRRAYHDEARIYGVQDDLETEHAGALMR
VWRRLNRIAVALLACALVLSCILVGRPAHVDAQDEQSSNRDIILCLDVSGSTLPYDHQVL
STYLNLLQHFKGERIGLSIFNSSSRTVFPLTDDYAMVTEQLTQANDMLKGVQTQDDIDKM
SDEQYQQIADWLEGTQNRKNATSLIGDGLVGCAAMLPGFAYSKADTAQSRSREASIVLAT
DNVVSGSPTYSLAQALDLTSQAGINVDGLYSGPQSSEGDATTNEMRQLIERHGGLFLTQS
NSASIDELVREIDGRRSHEAQAQSQTALTDVPGWWTLAVAILLAGWLVMAWRLKR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtggcaatgatgcttcgttggcaatggccgtgggcattggtggccgcattgctgatcgcc
gccctggtatgcctgacgatcgtcatggtatcgtcacatcggcgcgcctaccacgatgaa
gcgagaatctacggtgtacaggatgatcttgagaccgagcatgccggtgcgctgatgcgc
gtctggcgccgtctgaaccgcatcgccgtggcattgctcgcttgtgcgcttgtcctctcc
tgcattctcgtaggcaggcctgcgcatgtggatgcacaggacgagcaatcatcgaaccgc
gacatcatcctgtgtctcgacgtctcaggatccacgcttccctacgatcatcaggtactt
tccacgtatttgaatctgctgcagcatttcaagggtgagcgcataggcctgagcatcttc
aactcatcgtcgcgtacggtgttcccgctcaccgatgactacgcgatggtgaccgagcaa
ctcacgcaggcgaacgacatgctcaaaggcgtgcagacccaggacgatatcgataagatg
agcgacgaacaataccagcagattgccgactggcttgagggcacacagaaccgcaagaac
gccacttcactcatcggagatggattggtgggctgtgccgcaatgcttcccggattcgcc
tattcgaaggccgacactgcgcaatctcggtcgcgggaggcgtcgattgtgctggccacc
gacaatgtggtctcgggctcccccacctattcgttggctcaggcgcttgatctcacctcc
caagccggcatcaatgtggacggtctgtattcgggaccgcaatccagtgagggtgacgcc
acgaccaacgagatgcgccaactcatcgagcggcatggcggtctgttcctcacccagtcg
aacagcgcgtcgatcgatgaattggtgcgtgagatagacggtcgtcgttcacatgaggca
caggcccaatcacagactgccctgacggacgtcccgggatggtggactctcgctgtggcg
attctgcttgcgggctggttggttatggcgtggaggttgaagcgatga

DBGET integrated database retrieval system