KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00778Help
Entry
BIF_00778         CDS       T01840                                 

Definition
(GenBank) Glutamate-binding protein
  KO
K10005  glutamate transport system substrate-binding protein
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
bbb02010  ABC transporters
Module
bbb_M00233  Glutamate transport system
Brite
KEGG Orthology (KO) [BR:bbb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BIF_00778
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbb02000]
    BIF_00778
Transporters [BR:bbb02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamate transporter [MD:M00233] [OT]
    BIF_00778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 LysR_substrate
Motif
Other DBs
NCBI-ProteinID: ADC85696
UniProt: D3R4M2
Position
1426332..1427171
Genome map
AA seq 279 aa AA seqDB search
MKHRYKKGLARKAIAMVCAASALFGMAACGSSSADGEKKIRIGIKYDQPGLGFKKSGTFE
GFDVDVARYVANQLGYTDAEIEFLEAPSKQREAMLQNGDVDMILATYSITDERKKAVSFA
GPYFVAGQDLMVRADDHSINGPEDLNGKRLCSVTGSTSAKVVKERFAKEVQLMEQPGYAE
CATALFSGIVDAVTTDDIILAGLASASRGKLRVVGKPFTQEYYGVGIRKGDTAFAKQINA
AIEDMIKSGEWERAIEKNTEGTDYQPDPKYNPPTPDEGE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatagatacaagaaggggttggcgcgcaaggcaatcgccatggtgtgcgccgcc
agtgcgctgttcgggatggcggcctgcggttcgtcgtcggcggacggcgagaagaaaatc
aggatcggcatcaaatacgaccagcctggcttgggattcaagaagagcggcacattcgaa
ggctttgacgtcgacgtggcacgatatgtagccaatcaactggggtataccgatgccgag
atcgagttcctcgaggctccgtcgaaacaacgcgaagccatgttgcaaaacggtgatgtc
gacatgatcctggcgacctattcgatcaccgacgagcgcaagaaggcggtttcgttcgcg
gggccgtacttcgtggcggggcaggatctaatggtgcgcgcagacgaccattcgatcaac
ggtccggaggacctcaatggcaaacgcctgtgctccgtgaccggttccacgtcggccaag
gtggtgaaggagagattcgccaaggaggtccagctgatggagcagcccggttatgccgaa
tgcgccacggcgctcttctccggcatcgtcgacgcggtgaccaccgatgacatcattctg
gccggtctggcctcggcgtcccgtggcaagctgcgtgtggtgggcaagccgttcacgcag
gaatactacggggtgggcatcaggaagggtgacaccgcattcgccaagcagattaacgcc
gccattgaagacatgatcaagagcggtgagtgggaacgggccatcgagaagaacaccgaa
ggcaccgattaccaaccggatccgaaatataacccaccgacaccggacgaaggggagtga

DBGET integrated database retrieval system