KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00858Help
Entry
BIF_00858         CDS       T01840                                 

Definition
(GenBank) PHP domain containing protein (TRPH)
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Brite
KEGG Orthology (KO) [BR:bbb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BIF_00858
Enzymes [BR:bbb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     BIF_00858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: ADC84645
UniProt: D3R6B3
Position
complement(152177..153091)
Genome map
AA seq 304 aa AA seqDB search
MAVTFVYDGTMSEYVMPTRPPQEGWDLHCHTVFSDGTRTPREMVQEAKSLGLHGVAIADH
DTTAGWEEAGQASHDLHLPLMRGTEITAQDGNVSVHMLAYLYDPRNRHICDLFEKTRRSR
VERTKKMVALLAKDYPISWQSVLEQTKEGSRTTIGRPHIADALVAAGVYANRNEAFADAV
STHSKYYIPTPSPSTSEVVRAVEGAGGVSVIAHAADPSRNRVLLSNEQIARLADEGLDGL
EVWHRGNPEDQRARLLALAQRYHLLVTGGSDWHGAGKPNALGENLTDDATVAEIVRRGAI
PLCR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtggcggttacattcgtttacgatggaaccatgagtgaatatgtcatgccaacgagaccg
ccgcaggagggctgggatctgcattgccataccgtgttctcggatggcacgcgcacgccg
cgtgaaatggttcaggaggcgaagtcactcggcttgcatggtgtggcaatcgccgaccac
gatacgaccgccggatgggaggaggccgggcaggcgtcacacgacctccatctgccgctg
atgcgcggtacggaaatcaccgcgcaggatggcaatgtctccgtgcacatgctcgcgtac
ctgtacgatccacgcaacaggcatatatgcgacctgttcgagaagacacggcgctcgcgt
gtggagcgcacgaagaagatggtcgcactgcttgccaaggattatccgatttcctggcag
agcgtgctcgaacagaccaaggagggctcgcgcacgacaatcggacgcccgcacatcgcc
gacgcgctcgtggccgccggcgtgtacgcgaaccgcaacgaggcgttcgccgatgcggtg
agcacgcacagcaaatactacatacccacgccgtcgccatccacaagcgaggtggtgcgt
gcggtggagggtgccggcggtgtctcggtgatcgcacatgcggctgatccgagccgcaat
cgcgtgctgctttccaacgaacagattgcgcgcctcgccgatgaggggcttgacggtctt
gaggtatggcatcgcggtaatcccgaggaccagcgtgcgcgcctgcttgcattggcacag
cggtatcacctgctcgtcaccggaggctcggactggcatggggcgggcaagccgaacgcg
cttggcgagaatctcaccgatgacgccaccgtggcagagatcgtacggcgcggtgcgatt
ccgctgtgtcgttga

DBGET integrated database retrieval system