KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00879Help
Entry
BIF_00879         CDS       T01840                                 

Definition
(GenBank) Mrp protein
  KO
K03593  ATP-binding protein involved in chromosome partitioning
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Brite
Chromosome and associated proteins [BR:bbb03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BIF_00879
Mitochondrial biogenesis [BR:bbb03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-I assembly factors
    BIF_00879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParA FeS_assembly_P CbiA AAA_31 ArsA_ATPase MipZ CLP1_P Methyltransf_25 CBP_BcsQ Fer4_NifH
Motif
Other DBs
NCBI-ProteinID: ADC85721
UniProt: D3R4P7
Position
complement(1460002..1461114)
Genome map
AA seq 370 aa AA seqDB search
MTDQTQIIETAVIERLSHVIDPELGRSVTDLGMICGVDVRPTGLDSFNVRVNVELTVPGC
PLSAEISRQIEAAVTSYAEAQLTAEIVVGAMDEEKLKSLVNDLKAARRENPFSKPGTKTR
IFAIASGKGGVGKSSISANLAATFAALGYDTAAIDADIYGFSLPRLFGVHDQPTNLNGML
MPVTAWGVKLMSIGMFAGSDRAILWRGPRLQRSLEQFLADVWWGEPDVLILDLAPGTGDM
AISVAQALPNAELVVVTTPQPSASDIAVRSGLVALQVPMRVRGVVENMSYFEHAGERIDI
FGTGGGARVSSQLTDALHYEVPLMAQLPLDPRIREIGESEGRPAVLNDDGTLRDDDFGRT
FGHLAKSLLA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcagacgcagattatcgaaaccgccgtcattgagcggctcagccacgtgatc
gaccctgagcttggccgctcggtcaccgatctgggtatgatctgcggcgtcgatgttcgc
cccacaggcctggattccttcaatgtgcgggtcaatgtggagctcaccgtgcctggctgc
ccgctgtctgccgagatcagcaggcagatcgaggcggccgtgaccagttatgccgaggcg
cagctcaccgccgagatcgtcgtcggcgcgatggatgaggagaaactcaagtcgctggtg
aacgatctgaaagccgcccgtcgtgagaacccgttcagcaaaccgggtacgaaaacgcgc
atcttcgccatcgcctcaggcaagggtggcgtgggaaagtcttccatctccgccaatctt
gcggccacgttcgccgcactcggctacgacaccgcggccatcgacgccgatatctacggc
ttctcgctcccccgcctcttcggcgtccacgaccagcccacgaatctgaacgggatgctg
atgccggtgaccgcgtggggcgtcaaactcatgtcgattggcatgttcgccggttccgac
cgtgccattctatggcgaggcccccgtctgcagcgttcgctcgaacagtttctggccgat
gtgtggtggggcgaacccgatgtgctgattcttgatctcgcccccggcaccggcgacatg
gcgatttcggtggcgcaggcattgccgaacgccgagctcgttgtggtcacgaccccacag
ccctccgcgtcggacatcgccgtgcgttccggcctggtcgcacttcaggtgccgatgcgg
gtgcgtggcgtggtggagaacatgagctatttcgagcatgcaggcgaacggatcgacata
ttcggcacgggaggcggagctcgtgtgagttcccagttgaccgatgcgctgcactatgag
gtgccgctcatggcgcaattgccgctcgacccgcgtatccgtgagatcggcgaaagcgag
ggacgtccggccgtgctcaatgatgacggcacgctccgcgacgacgacttcggtcgtacc
ttcggacatctggccaagagtcttctggcatag

DBGET integrated database retrieval system