KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00891Help
Entry
BIF_00891         CDS       T01840                                 

Definition
(GenBank) hypothetical protein
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1510 TMEM154 ECSCR EphA2_TM Stevor Shisa DUF4064 RIFIN SARAF Orf78 ASFV_J13L IncA DUF4834 OAD_gamma SUR7 DUF4307 Flagellin_IN Mobilization_B Amnionless COX2_TM SID-1_RNA_chan DUF5385 Chordopox_A13L OSTbeta DUF4448 Tmemb_9 CD34_antigen PrgH MAP17 DUF2207 PspB Syndecan DUF3377 BSMAP DUF5469 ODV-E18 Baculo_11_kDa DUF2615 Pox_EPC_I2-L1 Imm17
Motif
Other DBs
NCBI-ProteinID: ADC85683
UniProt: D3R4K9
Position
1408687..1409778
Genome map
AA seq 363 aa AA seqDB search
MTLHAPLHRVRCNKNRGTTCSSPATVDFMANNNEWTAQQAIVVGGRGDDPVIVDNFGGLK
RQARVWTAVLSVIMLFAALLVGATGAQMAAADDSPSPSASESSSPSALVEDSQGYITDPQ
NLLGDNLTKVIDAANRTKQETGVTVRLLYLESFNTTEKPEQWASQLLESLNPPANTVMLA
VASHDGNLVVVVSPNSDEWLRSQSTVDQLSEAASKPLLDQQAGQGPNWSQSAIDMMDAIA
SAKSTATTHAVSSVSIIVMIIVFVVLIVVVLVMIFMRRKREVSEGSKQTEEVGKTRNDDA
MQLDNADDDLDVTAMAPEETSEQPEGKEAQEPNPTSEASGMPAPRRGRHAAAPHDDERFK
RPN
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgacattgcatgctcctttgcatcgtgttcgttgtaataaaaaccgcgggacaacgtgc
agctctcccgctactgttgactttatggcgaacaacaacgaatggacagcgcaacaggca
attgtggtcggaggacgtggtgacgatccggtcattgtggataacttcgggggcctcaag
cggcaggcccgcgtctggacggcggttctctccgtcattatgttgttcgcggcgctcctc
gtaggcgccactggtgcccaaatggctgcggcagatgattctccgtcgccgtctgccagc
gaatcgtcgagtccgagtgccttggtggaggactctcaggggtacatcaccgatccgcag
aacctgcttggcgacaatctcaccaaggtgatcgatgcggcgaatcggacgaagcaggag
acgggcgtgacggtgcgtctgctctacctcgaatcgttcaataccacagagaagccggaa
caatgggcctctcaactgttggagtcgctcaaccctccagccaacaccgtcatgcttgcg
gtggcctcccatgatggcaatctcgtcgtcgtggtctcaccgaattccgacgaatggctt
cgcagccaaagcaccgtggaccagctttcggaggccgcgagcaaaccgctgctcgatcag
caggccggtcaggggccgaactggtcccaatccgccatcgacatgatggatgccattgcc
agcgcgaaatcgaccgccaccacccatgccgtgagctcggtgagcatcatcgtcatgatc
attgtgtttgtcgtgctcatcgttgtcgtgctggtcatgatcttcatgcgccgtaagcgt
gaagtgagcgaaggctccaagcagaccgaggaggttgggaagacgcggaacgacgacgcc
atgcagttggacaacgccgatgatgaccttgatgtcaccgccatggccccggaagagaca
tccgagcaacccgaaggcaaagaggcgcaagagccgaacccgacctccgaagcgtctgga
atgcctgccccgcgtcgcgggcgccatgctgcggcaccgcatgatgacgaacgattcaaa
cgcccgaattaa

DBGET integrated database retrieval system