KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00948Help
Entry
BIF_00948         CDS       T01840                                 

Definition
(GenBank) Phosphoribosylformylglycinamidine cyclo-ligase
  KO
K01933  phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.3.1]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
bbb00230  Purine metabolism
bbb01100  Metabolic pathways
bbb01110  Biosynthesis of secondary metabolites
bbb01130  Biosynthesis of antibiotics
Module
bbb_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bbb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BIF_00948
Enzymes [BR:bbb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.1  phosphoribosylformylglycinamidine cyclo-ligase
     BIF_00948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ADC85622
UniProt: D3R4E8
Position
complement(1338802..1339956)
Genome map
AA seq 384 aa AA seqDB search
MPPRNPPSISSPISSSQIFPIQIHTDSSIDLPISANRKVTMPQAYENAGVSVEAGYEVVK
RIKSHVARTNRPGVVSGIGGFGGLFDLASLGYNEPVLISGTDGVGTKLVIAKLMDKHDTI
GIDCVAMCVNDVVAQGAQPLFFLDYIACGKNDPAVLEQVVSGVADGCVQAGAALIGGETA
EMPGMYDEDEYDLAGFTVGCVERSKIVDGSTIEAGDVLIGLPSTGVHSNGFSLVRKALFE
QAGYTVHTRLPELDDRELGDVLLTPTKIYVKALMPLFEANLVRGVAHITGGGFIENVPRM
LPEGLAASIELGSWPVPPIFDVIEKAGDVDHMEMYNIFNMGLGMVVAIRPDRVDEAMNLL
EHAGEKAYRVGHVIEQVNERVDLA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaggaacccaccgagtatctcgtccccaatatctagttcccagattttcccg
atacagattcatacagattcatcaatcgacttgccgatttcggcgaacagaaaggtcaca
atgccacaagcatatgaaaacgcgggtgtgagcgtcgaagcgggctacgaggtggtcaag
cgcatcaaatcacacgtcgcacgcaccaaccgaccgggcgtggtgagcggcatcggcggc
ttcggaggcctcttcgacctcgcctcacttggctacaacgaaccggtgctcatctccggc
accgatggtgtgggcacgaagctcgtcatcgccaagctcatggacaagcatgacacgatc
ggcatcgactgcgtggccatgtgcgtcaacgacgtcgtggcgcagggagcccagccgctg
ttcttcctcgattacatcgcctgcggcaagaacgacccggcggtgctcgaacaggtcgtc
tccggcgtggccgacggctgcgtccaggcgggcgccgcgctcatcggcggcgagaccgcg
gagatgcccggcatgtacgacgaggatgagtacgatctggccggcttcaccgtcggctgc
gtggagcgatcgaagatcgtggacgggtcgacgattgaggcgggcgatgtgctcatcggg
cttccttcgaccggcgtgcattccaatggtttctcgctggtgcgcaaggcactgttcgag
caggccggctataccgtgcatacgcgtcttcccgagctggacgatcgggaactcggcgat
gtgctgctcacccccacgaagatctacgtgaaggcgctcatgccactgttcgaggccaat
ctcgttcgcggcgtcgcccacatcaccggcggcggcttcatcgagaacgtgcctcgcatg
ctgccggagggtctggccgcctccatcgagcttggctcgtggccggtgccgccgatcttc
gacgtgatcgaaaaagcgggcgatgtggatcatatggagatgtacaacatcttcaacatg
ggcctgggcatggtcgtggccattcgccccgaccgtgttgacgaggcgatgaaccttctc
gagcatgcaggtgagaaggcctatcgcgtcggccatgtgatcgaacaggtcaacgaacgc
gtcgacctggcctga

DBGET integrated database retrieval system