KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01074Help
Entry
BIF_01074         CDS       T01840                                 

Definition
(GenBank) Succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
bbb00020  Citrate cycle (TCA cycle)
bbb00640  Propanoate metabolism
bbb00660  C5-Branched dibasic acid metabolism
bbb01100  Metabolic pathways
bbb01110  Biosynthesis of secondary metabolites
bbb01120  Microbial metabolism in diverse environments
bbb01130  Biosynthesis of antibiotics
bbb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BIF_01074
   00640 Propanoate metabolism
    BIF_01074
   00660 C5-Branched dibasic acid metabolism
    BIF_01074
Enzymes [BR:bbb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BIF_01074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA CPSase_L_D2 Glu_synthase GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ADC85837
UniProt: D3R513
Position
complement(1580858..1582051)
Genome map
AA seq 397 aa AA seqDB search
MDLYEYQARQLLEEQDIDVPKAVFAQNSHEVAEAADIIGYPVVIKAQVKIGHRGQAGGVR
IAHDRDEAILISEDILPMTIHGHKVSGILVTEAKNILHEYYVSISVDRSSRDFDVLATAN
GGTEVEEVARKHPESVKRLHISALEDFDLEAATKMAESIGFYHADSAQAAQILLNMWRCF
KQNDATLVEINPLAKVGDPDDESSKSLCALDAKISLDDNAAFRHDGWKRFADPIVPDPFE
QRAREHNLHYVHLTGEVGVIGNGAGLVMSSLDAVAFAGEEQGTGVKAANFLDIGGGASSQ
VMCESLEIILSDPQVESVFINVYGGITSCEQVALGILEAADQLGASKPMVVRFEGNKADE
GLRILAEADNPNIHVCETMGQAAAEAARLAAHGKEER
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggatctttacgaatatcaggcacgtcagctgctcgaagagcaggacatcgatgtgccg
aaggcggtgttcgcacagaattcacatgaggtggccgaagccgccgacatcatcggatat
ccggtcgtgatcaaggcacaggtgaagatcggacatcgcgggcaggcaggcggtgtgcgc
attgcacatgaccgtgacgaggcgatactcatctccgaggatatccttccgatgaccatc
catggtcataaggtgagtggcatcctggtgaccgaagccaagaacatcctccacgaatac
tatgtgtccatctcggttgatcgctcctcgcgcgacttcgacgtcctggccacggccaac
ggcggcactgaagtcgaagaagtcgcacgcaagcatccggaatctgtgaaacggctgcat
ataagcgctcttgaggacttcgacctcgaagcagcaacaaaaatggccgagagcatcggc
ttctaccacgcggattcagctcaggcggcgcagatcctgctcaacatgtggcgctgcttc
aagcagaacgatgccaccctcgtggagatcaacccattggccaaagtcggcgacccggac
gacgaatcttcgaagtcgttgtgcgcattggatgcgaaaatctcactcgacgacaacgca
gccttccgtcacgatggatggaagcgctttgccgacccgatcgtcccggatccgtttgaa
cagcgtgcccgtgaacacaatctgcattacgtgcatctcaccggcgaggtcggtgtcatc
ggcaacggggcgggcttggtgatgagctccctcgacgccgtcgcattcgcgggcgaggaa
cagggcaccggtgtgaaggccgcgaacttcctcgacatcggcgggggagcctcctcgcag
gtcatgtgcgaaagccttgagatcattctctccgacccccaggtggaatccgtgttcatc
aatgtgtatggaggcatcacctcctgtgaacaggtagctctcggcattctcgaggcggcg
gatcagctcggcgcatccaagccgatggtcgttcggttcgaggggaacaaggccgatgag
gggcttcggattctcgccgaggccgataacccgaacatccatgtatgcgagaccatgggg
caggcggccgccgaggcggctcgtctcgccgcccatggcaaggaggagcgttaa

DBGET integrated database retrieval system