KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01091Help
Entry
BIF_01091         CDS       T01840                                 

Definition
(GenBank) Amidophosphoribosyltransferase
  KO
K00764  amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
bbb00230  Purine metabolism
bbb00250  Alanine, aspartate and glutamate metabolism
bbb01100  Metabolic pathways
bbb01110  Biosynthesis of secondary metabolites
bbb01130  Biosynthesis of antibiotics
Module
bbb_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bbb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BIF_01091
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BIF_01091
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bbb01002]
    BIF_01091
Enzymes [BR:bbb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     BIF_01091
Peptidases [BR:bbb01002]
 Cysteine Peptidases
  Family C44
   BIF_01091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_7 GATase_6 GATase_4 GATase_2 Pribosyltran
Motif
Other DBs
NCBI-ProteinID: ADC85623
UniProt: D3R4E9
Position
complement(1339913..1341469)
Genome map
AA seq 518 aa AA seqDB search
MSAELEEIHEECGIFGVWGHPDAARLTYFGLHALQHRGQEGAGIVSNDHGHLVGHRGLGL
LTQVFQDEKDIQRLQGDAAIGHVRYATAGSGGIDNIQPFVFRFHDGDMALCHNGNLTNCF
SLRRALEDEGAIFHSNSDTEVLMHLIRRSMRSGITDKLQEALNTVHGGFAYLIMTEHEMI
GALDPNGFRPLSLGRMTNGAYVLASETCALDVVGAERIRDIQPGEMIVIDDSGYRTQTYT
SRTQLSICSMEYIYFARPDSDIYGVNVHSARKRMGARLAQESPVDADMVIGVPNSSLSAA
SGYSEEAGLPNEMGLIKNQYVARTFIQPTQALREQGVRMKLSAVKSVVKGKRIAVIDDSI
VRGTTSKRIVQLLKEAGAAEVHMRISSPPLKYPCFYGIDISTTQELIAAKKSVEEIREFI
GADSLAFLSVDGLIESIGLHADAPYGGLCVAYFNGDYPTALDDYEEGFLNSLTPEDRVTL
PGYNGKKTMYEGTEYTMMQKPFGEHASQEPTEYLVPNI
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgcagaactcgaagagatccatgaggaatgtggcattttcggcgtatggggacat
cccgatgccgcacgcctcacttacttcggattacacgcattgcaacatcgtggtcaggag
ggtgccggcatagtctccaacgaccacggccacctggtagggcaccgcgggctcggattg
ctcacgcaggtgttccaggacgaaaaagacattcaacgacttcaaggcgatgccgcaatc
ggccatgtgcgctatgcgacggccggctcgggcggcatcgacaacattcagcccttcgtg
ttccgcttccatgacggcgacatggcgttgtgccataacggcaacctcacgaactgcttc
tcgctgcggcgtgcgctcgaagacgaaggcgccattttccattcgaactccgacaccgag
gtgctcatgcacctcatccgccgttccatgcgcagcggcatcaccgacaagctgcaggaa
gcgctcaacaccgtgcacggcggctttgcgtacctaatcatgacggaacatgagatgatc
ggcgcactcgatccgaatgggttccgccccctctcgctgggccgcatgacgaacggcgcg
tacgtgctcgcctccgagacctgtgcgcttgacgtggtgggtgcggaacgaatccgagac
attcagcccggcgagatgatcgtgatcgacgacagcggctaccgcacgcagacgtacacg
agccgcacgcagctgtcaatctgctcgatggaatacatctacttcgcccgccccgactcc
gacatctacggcgtgaatgtgcactccgcaagaaaacgcatgggcgcccgtctcgcacag
gagtccccagtcgatgccgacatggtgatcggcgtgccgaattcctcgctctccgccgcc
tccggctactccgaggaggccgggttgcccaatgagatgggtctgatcaagaaccaatac
gtcgcccgcacattcattcagcccacgcaggcattgcgtgagcagggcgtgcgtatgaag
ctttccgcagtcaagtcggtggtcaagggcaagcgcatcgccgtcatcgatgactccatt
gtgcgtggcaccacgtcgaaacgcatcgtgcagctgctcaaggaggcgggggcggccgaa
gtgcacatgcgcatcagctcgccgccgctcaagtacccgtgcttctacggcatcgacatc
tcgacgacgcaggagctcatcgccgcgaagaaatcggtcgaggagatccgcgagttcatc
ggcgcggattcgctcgcgttcctctccgtggacggcctgatcgagtcgatcggcctgcac
gccgacgccccgtacggcggcctgtgcgtcgcgtacttcaacggcgactaccccaccgcg
ctcgatgattacgaggagggcttcctcaactcgctcacccccgaagaccgcgtgacattg
cccggctacaacggcaagaagacgatgtacgagggcaccgagtacacgatgatgcagaag
ccgttcggcgagcatgcctcccaggaacccaccgagtatctcgtccccaatatctag

DBGET integrated database retrieval system