KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01117Help
Entry
BIF_01117         CDS       T01840                                 

Definition
(GenBank) Hydroxymethylpyrimidine transport ATP-binding protein
  KO
K16785  energy-coupling factor transport system permease protein
K16786  energy-coupling factor transport system ATP-binding protein [EC:3.6.3.-]
K16787  energy-coupling factor transport system ATP-binding protein [EC:3.6.3.-]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
bbb02010  ABC transporters
Module
bbb_M00582  Energy-coupling factor transport system
Brite
KEGG Orthology (KO) [BR:bbb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BIF_01117
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbb02000]
    BIF_01117
Enzymes [BR:bbb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     BIF_01117
Transporters [BR:bbb02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter [MD:M00582] [OT]
    Shared module
     BIF_01117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran CbiQ AAA_21 SMC_N AAA_23 AAA_16 AAA_29 AAA_25 AAA_15 AAA_24 NACHT AAA_18 AAA_30 AAA_28 AAA_22 AAA_13 RsgA_GTPase NTPase_1 FtsK_SpoIIIE MMR_HSR1 DUF3584 STAS AAA_33 CLP1_P
Motif
Other DBs
NCBI-ProteinID: ADC85714
UniProt: D3R4P0
Position
complement(1445388..1448471)
Genome map
AA seq 1027 aa AA seqDB search
MDNGQANPCGGLYIGSAISGKVKLLTGGSATGPCPHAEPATRASGGSGASPGPTVIVRMK
EMSSHECFFTPRFDFTQPGLRQPLHWGGRPRTLVHAAHRHVCVVRRTCHGGQFHRDSVDA
CRTLAQIRSIGHRLHSRRLRIRPLGCGHSQRARVRASSVRQPAGRSDGDSRGTRVFIAGR
LHLPQAFHTHRRTHRHPPRRRRRTRGGHRRQSVHHPALRAHEHAASRLDDRADSAAVQSA
QIRNQRRRELPVLSPGLQADRPMNASGFQIELRHVGFSYDGGETWALDDVNLGIRAGERV
CIVGANGSGKSTLLRVMAGLSAPDTGSVTLLGHTVFTDEGGADADAYACARRGIGAVFQN
PEDQIVTTVTADDVAFGPENLDVPANMIGARVHASLSCVDMLTAWGADPTHMSGGEQQRI
AIAGMLAIHSRLLVLDEPTAMLDPQARAEVLALLDRIQASGTTLVIVSHLPEELRHADRI
VHIEHGRITGEDCAQHMPQHDHHSPSVTTFAQLDTLARHVNTEHAGIIGAAPTAVVFDDV
SFRYERESADVLSHMNLRIPRGCLTAIMGPNGSGKTTFARLLCALDKPRGGRIVVEGIDV
TQARRRERRRLRRVLGFVMQHPERQLFAETVADDVAFGPTNQGLDAAQVRERVDWALDLV
GVSDLRGRNPFELSGGQQRLVAIAGIIACDPSVLVLDEPCAGLDTSASRHIERLMENLRH
RGVTVILICHDPDQVDRLADQVILFGNEQQGRAHADSGGEVQREVLSPTDTGYSWVSGLD
PRVKIVCILTVMCAAFAMNTWAQLAVGVLLTAALWGASRVGFTRLLRSVRGFLVLFAVMG
ALNIGVVHTGDVLVRIGPLPITTGGVSVAIIYTTRFAIVLILGALLLETTTPTRLTAAFS
SLLSPLRRLHWHTQETALVLSLALRFVPTLAQEALSIRDAQAIRGGSIESGSLPQRVNAM
CATIIPVFAGAIRHANNLSLALQARSFEEGRPRSTWHAMHIRGRDIVFMTLTVTTLAAII
AMNVFTI
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
gtggacaatgggcaggcaaatccgtgcggtggactatacataggtagtgcaatttcaggg
aaggtgaaactccttactggcggtagcgcaacgggcccgtgcccgcatgcggagcccgca
acccgcgcaagcggtggatctggtgcgagtccagggccaacggttatagtccggatgaaa
gaaatgagctcgcatgagtgttttttcacacccagattcgatttcacccaaccaggtctc
cggcagccactccactggggcggcagaccgcggacgctggtccacgcagcgcatcgccat
gtatgcgttgttcgtcgcacttgccatggcggtcagtttcatcgagattccgttgatgcc
tgccgcaccttggctcaaatacgatccatcgggcatcgtctgcattctcgcaggcttcgc
attcggcccctcgggtgcggtcatagtcagcgtgctcgggttcgtgcctcatctgttcgt
caacccgctgggcgcagtgatggcgattctcgtggcactcgggtattcattgccggtcgc
cttcatctaccgcaggcgttccacacgcacaggcgcactcaccggcatcctcctcggcgc
cgccgtcgcactcgcggcggccatcgtaggcaatctgttcatcaccccgctctacgcgca
catgagcatgcagcaagtcgcctcgatgatcgtgccgattctgctgccgttcaatctgct
caaattcgcaatcaacggcgtcgtgagcttcctgtgctatcgcccggtctgcaagctgat
cgcccgatgaacgcctcgggattccagatcgagctgcggcatgtcggattctcctatgac
ggcggtgagacatgggcgctcgacgatgtgaaccttggcattcgcgccggcgaacgcgtg
tgcatcgtcggtgcgaacgggtcggggaaatccacattgttacgtgtgatggccggactc
agcgcgcccgacacaggttccgtgacgctcttggggcacacggtgttcaccgacgaaggt
ggcgccgacgccgatgcgtacgcatgtgcacgacgtggcatcggcgcggtgttccagaat
cccgaggatcagatcgtcacgacggtgaccgccgacgatgtggcattcggcccggagaac
ctcgatgtacccgccaacatgatcggcgcaagggtgcatgcctcactttcctgtgtcgac
atgctcacagcatggggggccgaccccacacatatgagcggtggcgagcaacaacgcatc
gccatcgccggcatgctcgccatacacagccgtctgctagtgctcgatgaacccaccgcc
atgctcgacccgcaggcgcgcgccgaggtgctggcgctactcgatcgcatccaggcatcg
gggacgaccttggtgattgtctcgcatctgcccgaggaactacggcatgccgatcgcatc
gtgcatatcgagcacggcagaatcaccggtgaggattgcgcacagcacatgccgcaacac
gaccatcattcccccagtgtgaccacgttcgcccagctcgataccctggcccgacatgtc
aacaccgagcatgccggaataatcggggcggcaccaaccgctgtggtgttcgatgacgta
tcgttccgctatgagcgggaatcggcggatgtgctcagccatatgaatctacggattcca
cgcggatgcctgacggccatcatgggtccgaacggatccgggaagaccactttcgcgcgt
ctgctgtgcgcgctcgacaaaccgcgcggcggccgaatcgtggtggagggcatcgacgtg
acgcaagcgagacgacgcgagcgcagacgcttgcgtcgagtgctcggatttgtgatgcag
catcccgaacgccagctatttgccgaaacggtggccgacgatgtggcgttcggtccaacc
aaccagggtttggatgcggcacaggtgcgtgaacgcgtcgattgggctttggacctcgtc
ggcgtgtctgacctacgcggcaggaatccgttcgaactgtcaggcggccagcagaggctg
gtcgccatcgccggaatcatcgcctgcgatccgtcggtgctggtgctggacgaaccatgt
gcagggctcgacacctcggcgagcagacacatcgagcgcctgatggagaatcttcgccac
agaggggtcaccgtcattctcatttgccatgaccccgatcaggtggaccgtttggccgat
caggttatcctgttcggcaatgagcaacagggacgggctcacgcagatagcggcggcgag
gtccagcgtgaggtactctcccccaccgacacgggttactcctgggtgtccggcctcgac
ccacgcgtgaagatcgtatgcatcctcacggtgatgtgtgcggctttcgccatgaacacc
tgggcccagttggctgtgggtgtgctgctgacggctgctctctggggcgccagtcgtgtc
ggcttcaccaggctattgcgttcggtgcgtggcttccttgtcctgttcgcggtcatgggt
gccctcaacatcggtgtcgttcataccggtgatgtgttggtaaggatcggtcccctgccg
atcacgaccggcggcgtgtccgtcgccatcatctacacgacgcgctttgccatcgtgttg
atattaggtgctctcctgcttgagaccacgacccccacccgtctgacggcggcgttctct
tcgttgctctcaccgctgcggcgactgcattggcatacgcaggagacggcattggtgctg
tcgttggccctgcggttcgtgcccacgttggcccaggaggcactctccattcgagatgcg
caggcgattcgtggcggttccatagaatcgggttccctgccacaacgggtcaacgcgatg
tgcgcgaccatcataccggtattcgccggcgccatacgccatgccaacaacctgtcgttg
gccctgcaggcacgctccttcgaagaggggcgcccccgctccacctggcatgccatgcac
atacgcggccgtgacatcgtgttcatgacgctcaccgtgacgacgttggcggccataatc
gccatgaatgtgttcaccatatga

DBGET integrated database retrieval system