KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01164Help
Entry
BIF_01164         CDS       T01840                                 

Definition
(GenBank) Uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
bbb03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bbb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BIF_01164
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bbb03400]
    BIF_01164
Enzymes [BR:bbb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     BIF_01164
DNA repair and recombination proteins [BR:bbb03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     BIF_01164
 Prokaryotic Type
     BIF_01164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ADC85678
UniProt: D3R4K4
Position
complement(1404351..1405070)
Genome map
AA seq 239 aa AA seqDB search
MTEIKPLEELMDPGWAEALRPVEPQIRHMGRLLRERIGHGEHIAPASRNILRAFTIPFDS
IRVLIVGQDPYPTPGYAVGLSFSVAPNVHPLPKSLVNIFKELEDDLHVPPPCNGDLTPWT
HRGVELLNRCLTVEIGRPNSHQNLGWEPVTDCAVRALNNRVDEHGKPKPLAAILWGRNAQ
TLEPLLTNAAIIKSAHPSPLSASRGFFGSHPFSRANAALKQMGAEPVDWSLPSSDCPAR
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaatcaaacctcttgaggaactcatggatccggggtgggccgaggcgctgcgc
ccggtggagccgcaaattcgccatatggggcgtctgttgcgtgaacgtatcgggcatggc
gaacatatcgcccccgccagccggaacatactgcgcgccttcaccattcccttcgactcc
atccgtgtgctcatcgtgggccaagacccctatcccactccaggctacgcagtgggattg
agcttctcggtggcgccaaacgtccacccgctgccgaagagccttgtcaacatattcaaa
gagcttgaagatgatctgcacgtgccgccaccctgcaacggcgacctcactccttggacc
caccggggggtggaattgctcaaccgctgcctcaccgtcgagattggcaggccgaacagc
caccagaacttgggctgggaacctgtgaccgattgcgctgtgcgtgcactcaacaaccgt
gtcgatgagcacggcaagccaaagccgctggcagcgattctctgggggcgtaacgcccag
accttggagccgttgctgacgaatgccgccatcatcaaatccgcacaccccagcccgctg
tcggcatcgcgcggtttcttcggatcacatcccttctcccgcgcgaacgcagcactcaag
cagatgggagccgaaccggtcgactggtcgctgccatcgtccgattgccctgcacggtaa

DBGET integrated database retrieval system