KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01181Help
Entry
BIF_01181         CDS       T01840                                 

Definition
(GenBank) Phosphoribosylaminoimidazole carboxylase NCAIR mutase subunit
  KO
K01589  5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
bbb00230  Purine metabolism
bbb01100  Metabolic pathways
bbb01110  Biosynthesis of secondary metabolites
bbb01130  Biosynthesis of antibiotics
Module
bbb_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bbb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BIF_01181
Enzymes [BR:bbb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.18  5-(carboxyamino)imidazole ribonucleotide synthase
     BIF_01181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp 2-Hacid_dh_C Dala_Dala_lig_C ATP-grasp_5 ATPgrasp_Ter NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ADC85617
UniProt: D3R4E3
Position
1331476..1332627
Genome map
AA seq 383 aa AA seqDB search
MPSLSDETGGQITRLLPGATIGIVGGGQLGRMMALAAKYMGFRIGTLDPTPDCPTAQVAD
FQIVADYDDQDAIHELAERSDVLTYEFENVDADALDAVRDIVAIPQGTDLLRVTQNRIAE
KTFINDHGIATAPWRPVGSRAELDAALAEIGYPAVLKTCEGGYDGHGQIVLRTPDDLAEV
WPDEGFPQAILEGFVDFAFEASILVSGNGDDYQTFPIVRNIHRDNILHLTLAPADVDEQV
ARTAHELALELARGFKLAGTLAIELFVKADGTVIVNELAPRPHNSGHYTIEACDFDQFDM
HVLGIAGWNLPTPRLLSPAVMVNVLGQHIAPTQAVEPMHPEWHVHDYGKAEAKFNRKMGH
ITVLCENPRDAAQSLEQTGCWDC
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcttatctgacgaaaccggcggccagatcacgcgtctgctgccgggggcgacc
atcggcatcgtcggcggaggccagctcggccgcatgatggcgcttgccgcgaaatacatg
ggcttccgcatcggcacgcttgacccgacacccgattgccccaccgcgcaggttgccgac
ttccagattgtcgccgactacgacgaccaggatgcgattcacgagctcgccgaacgcagc
gacgtgctcacctacgagttcgagaacgtggatgccgacgcattggatgcggtccgcgac
attgtggcgattccgcagggcaccgacctgctgcgcgtgacacagaaccgcatcgccgag
aagacgttcatcaatgaccatggcatcgccacggcaccatggcgaccggtgggctcacgc
gcagagctcgacgcggcgctcgccgagatcggctacccggccgtgctcaagacctgtgaa
ggcggttatgacggccatgggcagatcgtgttgcgcacaccggacgatctggccgaggtc
tggcctgatgagggcttcccgcaggcgatactcgaggggttcgtcgatttcgcgttcgag
gcctccattctggtgagcggcaacggcgatgattaccagacgtttccgatcgtgcgcaac
attcaccgcgacaacatcctgcatctcacgcttgccccggcggacgtggacgaacaggtg
gcgcgcaccgcgcatgaactggcgctcgagctcgcgcgcggcttcaaattggcgggcacg
ctcgccatcgaactgttcgtcaaggcggacggcaccgtgatcgtcaacgagctcgcaccg
cgcccacacaattccggtcattacacgatcgaagcctgcgatttcgaccaattcgacatg
catgtgctcggcatcgccggctggaatctgcccacaccgcgtctgctcagccccgcggtc
atggtgaacgtgctcggccagcatatcgcacccacgcaggccgtggagccgatgcatccc
gaatggcatgtgcacgactacggcaaggccgaggccaagttcaaccgcaagatggggcac
atcaccgtgctgtgcgagaatccccgggatgcagcgcagtcattggaacagacaggctgc
tgggattgttga

DBGET integrated database retrieval system