KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01182Help
Entry
BIF_01182         CDS       T01840                                 

Definition
(GenBank) Ferric uptake regulation protein
  KO
K03711  Fur family transcriptional regulator, ferric uptake regulator
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Brite
KEGG Orthology (KO) [BR:bbb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bbb03000]
    BIF_01182
Transcription factors [BR:bbb03000]
 Prokaryotic Type
  Helix-turn-helix
   Fur family
    BIF_01182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FUR HTH_32 APH_6_hur HTH_12
Motif
Other DBs
NCBI-ProteinID: ADC85618
UniProt: D3R4E4
Position
1332584..1333069
Genome map
AA seq 161 aa AA seqDB search
MQRSHWNRQAAGIVEQSGTDSRIRKVRNMGERNTRQKDVIREALQGADDFISAQQLHARL
EDAGEHIALATVYRQLGTMADAKQVDTVRLNGQQLFRLCNAGGHHHHLMCVSCGRTVEID
PPSEAWLQSVAQQHDFTIESHTLEVFGLCADCRAARGDCAA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcagtcattggaacagacaggctgctgggattgttgaacagtctggtacagat
tcacggattcgcaaggtgaggaacatgggcgagcgcaatacacggcagaaggacgtcatt
cgggaggcgttgcagggtgcggacgacttcatctccgcacagcagctgcatgcgcggctc
gaggacgccggcgagcatattgcactcgccaccgtgtaccgccagctggggacgatggcc
gacgccaagcaggtggacaccgtgcggctcaatgggcagcagctgttcagactgtgcaac
gccggcggccatcaccatcacctcatgtgcgtgtcgtgtggcagaacggtggagatcgat
cctccgagcgaggcgtggctgcagtccgtggctcagcaacatgacttcaccatcgagtcg
catacgctcgaggtgttcggcctgtgcgcggactgccgtgccgcacgcggtgactgtgca
gcctga

DBGET integrated database retrieval system