KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01202Help
Entry
BIF_01202         CDS       T01840                                 

Definition
(GenBank) Cyclopropane-fatty-acyl-phospholipid synthase
  KO
K00574  cyclopropane-fatty-acyl-phospholipid synthase [EC:2.1.1.79]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Brite
KEGG Orthology (KO) [BR:bbb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BIF_01202
Enzymes [BR:bbb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.79  cyclopropane-fatty-acyl-phospholipid synthase
     BIF_01202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CMAS Methyltransf_23 Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_31 MTS Methyltransf_18 PrmA Ubie_methyltran PCMT Methyltransf_2 DOT1 MetW TPMT UPF0020 Cons_hypoth95 Methyltransf_4 Met_10
Motif
Other DBs
NCBI-ProteinID: ADC85657
UniProt: D3R4I3
Position
1379946..1381235
Genome map
AA seq 429 aa AA seqDB search
MNMAAMTVAQMIELFLKPGAPVHIESFDGSSYGSDDAPLTLQVKNSRAIYYMVNAPSELG
LARAYLQGDIDSPQLVPGNPYALFKELVPLKSYLRTPNPAQLAKALASVASHGFHRPAPP
DIEGPSRARRISEGLLPHSKAGDEATVSYHYDQSNEFYSMFLGPSMTYTCAVFDSPLMSL
EAAQKNKIDLVLDKLALQPGERLLDIGCGWGSMVIEAAKRGIKALGVTLSEEQVEWAQRW
IKDEGLEDLAEVRLMDYRDVPEGDFDGICSIGMMEHVGHKHYPSYFKEIYAKLKPGAKLL
NHQITRCNSHQGKKAGQFIDRYIFPDGELSSPAEIEMVIQDTGFEVINQENLRQHYALTL
HRWNENLVAHWDDAVKLVGEPKARLWGLYMAGCAFNFEMNNIQVHQFLAIKPNDEGTDTY
PLRPWWPNH
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaatatggccgcaatgaccgtggcacagatgatcgagctgttcctcaagccgggtgca
cctgtgcatattgaaagtttcgatgggtcgtcgtatgggtccgacgatgctccgctgacg
ttgcaggtgaagaactcgcgcgccatctactacatggtgaatgcgccgagcgagctcggc
ctggcccgcgcctacctgcagggggacatcgattcgccgcagctcgtgcccggcaatcca
tatgcgctgttcaaggaactcgtaccgctcaagtcgtacctgcgtacaccaaatccagcc
caactggccaaggcgctcgcttcggtggcctcccatgggttccaccgtcccgcgcctccc
gatatcgagggcccaagccgtgcccgccgcatcagcgaaggactgctgccgcattcgaag
gccggcgacgaggccacggtgagctaccattacgatcagtcgaacgaattctattcgatg
ttcctgggaccatccatgacctacacctgcgcggtgttcgactccccgctcatgtcgctc
gaggccgcgcagaagaacaagatcgacctcgtgctcgacaagctcgcactccagccggga
gaacgactgctcgacataggttgcggttgggggtccatggtgatcgaagctgccaagcgc
ggcatcaaggccctcggcgtcacgctgagcgaggagcaggtcgaatgggctcagcgctgg
atcaaagacgaaggactggaggacctcgccgaggtgcgactcatggactatcgtgacgtt
cccgaaggcgatttcgacggcatctgctccatcggcatgatggagcatgtcgggcacaag
cactacccgtcgtatttcaaggagatctacgccaagctcaagccgggcgccaaattgctc
aaccaccagatcacccggtgcaactcgcatcagggcaagaaagccggtcagttcatcgac
cgttacatattcccggacggcgagctctcctcaccggccgagatcgagatggtgatccaa
gacacgggcttcgaggtgatcaatcaggagaacctccgccagcactatgcactcacgctg
caccgttggaacgagaatctggtggcgcattgggatgacgccgtcaagctcgtcggtgag
ccgaaggcccgtttgtgggggctctatatggccggttgcgcgttcaatttcgagatgaac
aacattcaggtgcatcagttcctcgccatcaaaccaaacgatgagggcactgacacctac
ccgttgcgtccatggtggccgaaccactga

DBGET integrated database retrieval system