KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01203Help
Entry
BIF_01203         CDS       T01840                                 

Definition
(GenBank) S-adenosylmethionine synthetase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
bbb00270  Cysteine and methionine metabolism
bbb01100  Metabolic pathways
bbb01110  Biosynthesis of secondary metabolites
bbb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BIF_01203
Enzymes [BR:bbb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     BIF_01203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N AdoMet_Synthase RTP1_C2
Motif
Other DBs
NCBI-ProteinID: ADC85656
UniProt: D3R4I2
Position
1378606..1379832
Genome map
AA seq 408 aa AA seqDB search
MAEVKLISAESVTEGHPDKICDQISDAILDDMLRQDPHSHVAVETSATKGQFWVFGEVTS
KGYSDIQSIVRDTVRRIGYTSSVIGLDADSCGVLVSLSEQSPEINQGVSRIDSDRENAVS
REERYEAQGAGDQGVMFGYASDETDVLMPLPIHLAHRLAYRLAEVRKNGEVKFLRPDGKT
QVTIEYDEENRPLRVDTVLISTQHDPEVSQEALREDLREHVIEPVLDEVLGDAVKHDDYR
VLVNPTGSFIMGGPAADAGLTGRKIIVDTYGGAAHHGGGAFSGKDPSKVDRSAAYAARWV
AKNIVAAGLAHKVEVQVAYAIGVAEPVSINVETYGTEADGVTREQIQEAVRKVFDLRPAA
IVDELDLLRPIYSKTAAYGHFGREDDDFTWEHTNKVDELKRAIATLVD
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtgaagctgatctccgcggaatccgttaccgaaggacatcccgacaagatc
tgtgatcagatttccgacgccattctcgacgacatgctccgccaggacccgcattcacat
gtggcggtggagacatccgccacgaagggccagttctgggtgttcggcgaagtgacgagc
aaagggtactccgacatccagagcattgtgcgcgacacagtgcgtaggatcgggtacacc
agctcggtgattggtctggatgcggattcctgtggcgttcttgtttcactgagcgaacaa
agccctgaaatcaaccaaggtgtttcccggatcgactcggaccgggagaacgccgtctcg
cgcgaggagcgctacgaggcacaaggagcgggcgaccagggtgtcatgttcggttatgca
agcgacgaaaccgatgtgctcatgccattgccgatccatctggcacatcgcctggcatat
cggctcgcagaggtgcgtaagaacggcgaggtgaagttcctgcgccccgacggcaagacg
caggtaaccattgaatacgacgaggagaacaggccgctgcgcgtcgataccgtgctcatc
tccacacagcatgatcccgaggtctcgcaggaggcattgcgcgaggatctgcgggagcat
gtgatcgagccggtgctcgatgaggtgctgggggatgcggtgaagcacgacgactaccgc
gtgctcgtcaatccgacaggttcgttcatcatgggcggtccggcagcggatgcagggctg
accggtcgcaagatcatcgtcgacacctatggcggtgcggcccatcatggcggcggcgcg
ttctcgggcaaggatccgagcaaggtggatcgttccgcggcctatgccgcacgttgggtc
gccaagaacatcgtggccgcgggtttggcccataaggtcgaggtgcaggttgcctacgcc
atcggcgtggccgagccggtgagcatcaatgtggagacctacggcaccgaggcggacggc
gtgacccgcgagcagattcaggaagccgtgcgcaaggtgttcgatctgcgtcctgccgcg
attgtggacgagctcgacctgctgcgtccgatctactcgaagacggctgcgtacggccac
ttcggacgtgaggacgatgacttcacttgggagcacaccaacaaggtcgatgagctcaag
cgggccatcgccaccctcgtcgactga

DBGET integrated database retrieval system