KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01343Help
Entry
BIF_01343         CDS       T01840                                 

Definition
(GenBank) Hypothetical protein
  KO
K13570  prokaryotic ubiquitin-like protein Pup
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Brite
KEGG Orthology (KO) [BR:bbb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bbb04121]
    BIF_01343
Ubiquitin system [BR:bbb04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   BIF_01343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pup Med2
Motif
Other DBs
NCBI-ProteinID: ADC85664
UniProt: D3R4J0
Position
1390663..1390947
Genome map
AA seq 94 aa AA seqDB search
MNSPCGTGHIRHRYWNPHQIGGAMPSASGHHQIPAETQRHDDDQTQETAQGLSAAAMLAQ
EQADDLDAILDDIETVLETNAEEYVSSFVQKGGE
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
ttgaacagcccatgtggcacagggcacatccgacatcgatattggaatccacaccagatt
gggggagcaatgccatctgcatccggacaccatcagatccccgccgagacacagcggcat
gatgacgaccagacccaggaaacggcccagggtctttccgcagcggccatgcttgcgcag
gagcaggctgacgatctcgatgcgattctcgatgacatcgaaaccgttctcgagacgaac
gctgaggaatatgtgagcagcttcgtgcagaaaggcggcgagtga

DBGET integrated database retrieval system