KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01353Help
Entry
BIF_01353         CDS       T01840                                 

Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
bbb00670  One carbon pool by folate
bbb01100  Metabolic pathways
bbb01120  Microbial metabolism in diverse environments
bbb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BIF_01353
Enzymes [BR:bbb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     BIF_01353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA DUF1611 TyrRSs_C
Motif
Other DBs
NCBI-ProteinID: ADC85254
UniProt: D3R3D0
Position
908215..909732
Genome map
AA seq 505 aa AA seqDB search
MTLIENFTKPYGLVDKIDAFGYLDSLKNNPDAPRKQGKVVLVTADTPLKASRGEGKTTTT
IALIDALNERGIDAAAVLRQPSMGITAAGSKGGASGGGKASLTHPELIDWGLCGEMGSIE
AAQNLLVSFAEKAIDDGLLDTVLVPRVSEVPSRSLRQITVDRGKGNVPERVVLTPTCELM
QIVVLSRSMEEIADRVAHMIAGTKDGKPVTFGEFIDLWRITNILTDAVKPAKTETVNGSP
VYVHGGPFANVSIGIPTLVSVEMACALHDVVIVEAGYGADAGAQKWLDIACREYGAQWPS
AAVVVTRATTWRDDPALQWRYPFHVDRLEKLGIPTFPLINLWEGEDDQIPALRETAEELG
FRDPIVGNLFRDGGEALAPQLDAFVEAVSDEALPERPKSFKGESLREKIEFVCGNAYGVP
ADRVIDKAGFAESEAEAERLCADAGIDFADLALVAVKSPATMTDNDAAPADERTVTLKKV
EVHSGAGLVQVNLTTSLTTPMPKIV
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcttatcgagaacttcaccaagccttacggattggtagacaagatcgacgctttc
ggttacctcgactccctgaagaacaaccccgacgcaccgcgcaagcagggcaaggtggtg
ctcgtgacggcggataccccgctcaaggcatcacgtggcgagggcaagaccacgacgacg
atcgcgctcatcgacgcgctcaacgagcgtggcatcgatgcggccgccgttcttcgccag
ccgagcatgggcatcaccgcagccggttcgaagggcggtgcctccggcggcggcaaggcg
tcgctcacgcatcccgagctcatcgactggggtctgtgcggcgagatggggtcgatcgag
gccgcgcagaatctgctcgtgtccttcgccgagaaggctattgacgacggcttgctcgac
acggtgctcgtgccgcgcgtctccgaagtgccgtcgcgctcgctgcgccagattaccgtg
gaccgcggcaagggcaatgttcccgagcgcgtggtgctcacgccgacctgcgagctcatg
cagatcgtcgtgctgtcgcgctccatggaggagatcgcagaccgcgtggcgcatatgatt
gccggcacgaaggacggcaagcccgtgaccttcggcgaattcattgacttgtggcgcatc
acgaacattctcaccgacgccgtgaagcccgcgaaaaccgagaccgtgaacggctcgccg
gtgtacgtgcacggcggcccgttcgcgaacgtctccattggcattcctacgcttgtttcc
gttgagatggcgtgcgcgctgcacgacgtggtgatcgtcgaggccggctacggtgccgac
gccggcgcgcagaagtggctcgacatcgcatgccgtgaatatggcgcgcagtggccgagt
gccgcggttgtggtcacccgcgcgaccacctggcgcgacgatcctgccctgcagtggcgc
tacccgttccatgtcgatcgcttggagaagctcggcatccccaccttcccgcttattaat
ctgtgggagggcgaggatgaccagattccggccttgcgcgagactgcggaggaacttggc
ttccgcgacccgattgtgggcaatctgttccgcgatggcggcgaggcgctcgcaccgcag
ctcgacgcgttcgtcgaggcggtttccgacgaggcgctgcccgagcggccgaagagcttc
aagggcgagtcgctgcgcgagaagatcgagttcgtgtgcggcaatgcgtacggtgtgccg
gcagaccgcgtgattgacaaggctggtttcgccgagtccgaggccgaggcggagcgcctg
tgcgccgatgccggcatcgacttcgccgatctcgcgctggtggccgtgaagtcgccggcc
acgatgaccgacaacgacgccgcccccgccgacgagcgcaccgtgacactcaagaaggtg
gaggtgcattcgggtgccggtctcgtgcaggtgaacctgacgacgagcctgaccaccccg
atgccgaagatcgtctga

DBGET integrated database retrieval system