KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01752Help
Entry
BIF_01752         CDS       T01840                                 

Definition
(GenBank) Hypothetical membrane spanning protein
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YccF
Motif
Other DBs
NCBI-ProteinID: ADC85709
UniProt: D3R4N5
Position
complement(1442223..1442696)
Genome map
AA seq 157 aa AA seqDB search
MSHGRQTKRHVVSVQVPACSPMDIVRLAAYPWPAYTVGMRFIGNLIWLVLGGLEIAFAWF
VVGLVLCVTIVGIPLGVQSFKMAQLTLTPFGQHVVYGGSVGSLLLNIVWVVLVGWWMALG
YLIAGVLNCITVIGVPFGIQSFKMCKLALWPFGTTID
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacatggtcggcagacgaagcgccatgtcgtctccgtgcaggtccctgcatgttcg
ccgatggacatcgtgcgtttggccgcgtatccatggccggcctacactgtcggtatgaga
ttcatcggtaatttgatctggcttgttctgggtggtctggagatcgccttcgcctggttc
gtggtcggcctcgtgctttgtgtgacgatcgtgggcatcccgttgggtgtgcagtcgttc
aagatggcccagctcacgctcaccccattcggccaacacgtcgtctatggcggttcggtg
ggttcgctgctgctcaacatcgtatgggtggtgctggtcggctggtggatggcgcttggg
tatctcattgccggtgtgctgaattgcatcacggtgattggcgtgcctttcggcattcag
tcattcaagatgtgcaagcttgccctgtggcctttcggcaccaccattgactag

DBGET integrated database retrieval system