KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01803Help
Entry
BIF_01803         CDS       T01840                                 

Definition
(GenBank) Dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
bbb00010  Glycolysis / Gluconeogenesis
bbb00020  Citrate cycle (TCA cycle)
bbb00260  Glycine, serine and threonine metabolism
bbb00280  Valine, leucine and isoleucine degradation
bbb00620  Pyruvate metabolism
bbb00630  Glyoxylate and dicarboxylate metabolism
bbb00640  Propanoate metabolism
bbb01100  Metabolic pathways
bbb01110  Biosynthesis of secondary metabolites
bbb01120  Microbial metabolism in diverse environments
bbb01130  Biosynthesis of antibiotics
bbb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BIF_01803
   00020 Citrate cycle (TCA cycle)
    BIF_01803
   00620 Pyruvate metabolism
    BIF_01803
   00630 Glyoxylate and dicarboxylate metabolism
    BIF_01803
   00640 Propanoate metabolism
    BIF_01803
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BIF_01803
   00280 Valine, leucine and isoleucine degradation
    BIF_01803
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbb04147]
    BIF_01803
Enzymes [BR:bbb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     BIF_01803
Exosome [BR:bbb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BIF_01803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_dim Pyr_redox_3 FAD_oxidored NAD_binding_8 FAD_binding_2 GIDA HI0933_like DAO FAD_binding_3 Lycopene_cycl K_oxygenase Thi4 3HCDH_N ApbA
Motif
Other DBs
NCBI-ProteinID: ADC85725
UniProt: D3R4Q1
Position
complement(1464698..1466221)
Genome map
AA seq 507 aa AA seqDB search
MSPCMGTNETGTKRMTSEHYDVVIIGAGPGGYTVALRSAELGKSVLLVERDDVVGGTCLN
RGCIPSKALITATRTIDTIHRGEQIGIDCELQEIDFGKLRAFRDGTVSTMRDGLLALLTF
RGVHMVQGIASVVEDGHVHVRPAQGGQTIRIRTADGDFKDGGQSLDVTAGDVVIATGSRP
KPLDVAPFNHVLIDSTRALALNSFPHSAVVIGSGATALEFASMWNSAGADVTLIMRGDIV
LSRSDRRAAKILMRELKRQGITIVTNAAITAVDTGENLGVTVHYTDADGNGQEVFAEWAL
AAIGRVPNTDGAWFAKASIELDENGLVKTDAYGRTSREHVWALGDITPGHQLAHRAYQQG
YVVAETIAGLDPSPVDEYTIPTVVFSNPEFASVGYTLREAKADTELVDVTETLIPVMSNA
RMLMSGASGSVSVVSGKKSADQSDDVHVLGVHIVSPDASDLIAEAQQIIGNHVPLSAAAR
NIHPHPTFSEMLGETLLKADGRPLHTR
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgtgcatgggaacaaacgaaacaggaacgaagcgtatgacgagtgaacattac
gacgtggtaattatcggcgcaggccccggcggctacacagtggcgctgcgctcggcggaa
ctgggcaaatcagtgctgttggtggaacgcgacgatgtggtgggtggcacatgcctcaac
cgcgggtgcattccgtcgaaggcactcatcacggcaacgcgcaccattgacacgatacat
cgcggcgaacagatcggcatagactgcgagctgcaggaaatcgacttcggcaaactgcgt
gcgttccgcgatggcacggtctcgacgatgcgcgacggactgctcgcgctgctcaccttc
cgcggcgttcatatggtgcagggcatcgcctcggttgtagaggacggccatgtccatgtg
agaccggcacagggcgggcaaacgatccgcatccgcactgcagacggcgatttcaaggac
ggtgggcaatctctcgacgtcaccgcaggcgatgtggtgatcgccaccggctcacggccg
aaaccgcttgatgtggcgccgttcaatcatgtgctcatcgactcgacgagagcactggca
ctcaactccttcccacacagcgccgtggtgattggttcgggggccacggcgcttgaattc
gcgtcgatgtggaattccgcaggagcagacgtcacgctcatcatgcgcggcgacatcgtg
ctctcccgctccgacaggcgggctgcgaagatactgatgcgcgaactgaagcgacagggc
atcacgatcgtgacgaacgctgccatcacggcggtcgacactggggagaatctgggtgtc
accgtgcattacacggacgcagacggcaacgggcaggaggtattcgccgagtgggcgctc
gcagccatcgggcgtgtgccgaataccgacggcgcatggttcgcgaaggcatcgattgag
ctcgatgagaacggtttggtgaaaacggatgcctacggccgcaccagccgggaacatgtg
tgggcgttgggcgacatcaccccagggcaccaactggcacaccgtgcatatcaacaaggc
tatgtggtggccgaaacgattgccggactcgatccctccccggtggacgaatacacgatc
ccaaccgttgtgttctcgaacccggaattcgcctccgtcggctacacgctgcgcgaagcc
aaggccgacaccgagctcgtcgacgtaaccgaaacgctcatcccggtcatgtcgaacgcg
cgcatgctgatgagcggggcatccggttcagtgtcggtggtgagcgggaagaagtccgca
gatcaatcggatgacgttcatgtgctcggcgtgcatatcgtctcccccgacgccagcgat
ctgatcgccgaggcacagcagatcataggcaaccatgttccattgagcgctgccgcgcgc
aacattcacccgcacccgaccttcagcgagatgctcggggaaacgctgctcaaagccgat
ggccgaccgttgcacacccgctga

DBGET integrated database retrieval system