KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01845Help
Entry
BIF_01845         CDS       T01840                                 

Definition
(GenBank) Protein Translation Elongation Factor P (EF-P)
  KO
K02356  elongation factor P
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Brite
KEGG Orthology (KO) [BR:bbb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bbb03012]
    BIF_01845
Translation factors [BR:bbb03012]
 Prokaryotic Type
  Elongation factors
   BIF_01845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EFP_N EFP Elong-fact-P_C
Motif
Other DBs
NCBI-ProteinID: ADC85648
UniProt: D3R4H4
Position
1368592..1369164
Genome map
AA seq 190 aa AA seqDB search
MSNLAQTTNDIKNGSILNLDGQLWQVIKFQHVKPGKGPAFVRTTIKNVLSGKIVDKTFNA
GMKMDFETVDNRTLQYSYEDGDNFVFMDMTTFDQIMIPKTLVGDKAKYLLEGTDCIVSFH
DGQPLSVELPASVVLTITHTEPGLQGNRSNAGTKPATVETGAEIQVPLFIGEGEKVKVNT
DDGSYLGREN
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaatttggcacagactactaacgacatcaagaacggttccattctgaatctcgat
ggccagctctggcaggtcatcaagttccagcacgtcaagccgggcaagggccccgctttc
gtgcgcaccacgatcaagaacgtgctctccggcaagatcgtcgacaagacattcaacgcc
ggcatgaagatggatttcgagaccgtcgacaaccgcacgctgcagtactcgtatgaggac
ggcgacaacttcgtgttcatggacatgaccaccttcgaccagatcatgattccgaagacg
ctcgtgggcgacaaggccaagtacctcctcgaaggcaccgactgcatcgtctccttccac
gacggccagccgctgtcggtggaactgccggcatccgtcgtgctcaccatcacccacacc
gagccgggtctgcagggtaaccgttcgaacgcgggcaccaagccggccaccgtcgagacc
ggtgccgaaatccaggtccctctgttcatcggcgagggcgagaaggtgaaggtcaacacc
gacgacggctcctacctgggccgcgagaactga

DBGET integrated database retrieval system