KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01972Help
Entry
BIF_01972         CDS       T01840                                 

Definition
(GenBank) Protein Translation Elongation Factor Tu (EF-TU)
  KO
K02358  elongation factor Tu
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Brite
KEGG Orthology (KO) [BR:bbb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bbb03012]
    BIF_01972
   03029 Mitochondrial biogenesis [BR:bbb03029]
    BIF_01972
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbb04147]
    BIF_01972
Translation factors [BR:bbb03012]
 Eukaryotic Type
  Elongation factors
   BIF_01972
 Prokaryotic Type
   BIF_01972
Mitochondrial biogenesis [BR:bbb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BIF_01972
Exosome [BR:bbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BIF_01972
  Exosomal proteins of breast cancer cells
   BIF_01972
  Exosomal proteins of colorectal cancer cells
   BIF_01972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ADC85645
UniProt: D3R4H1
Position
1365413..1366660
Genome map
AA seq 415 aa AA seqDB search
MSDQGLLRERPGGQKHMAKEKYERTKPHVNIGTIGHVDHGKTTLTAAISKVLHDEYPDLN
PEYDFNQIDAAPEEQQRGITINIAHIEYQTAKRHYAHVDCPGHADFVKNMITGAAQMDGA
ILVVAATDGPMAQTREHVLLARQVGVPKILVALNKCDMVDDEELIELVEEEVRDLLDENG
FDRDCPVVHTSAYGALHDDAPDHDKWVATIKELMDDVDEYIPTPVHDLDKPFLMPIEDVF
TISGRGTVVTGRVERGKLPINTNVEIVGIRPTQTTTVTSIETFHKQMDECEAGDNTGLLL
RGINRTDVERGQVVAAPGSVTPHTKFEGEVYVLTKDEGGRHSPFFSNYRPQFYFRTTDVT
GVITLPEGVEMVQPGDHATFTVELIQPIAMEEGLTFAVREGGHTVGSGRVTKILA
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgatcaaggcttactacgagaacgtccaggaggacaaaaacatatggcaaaggaa
aagtacgagcgtactaagccgcacgttaacattggtaccatcggccacgtcgatcacggc
aagacgaccctgactgcagcaatctccaaggttctgcacgatgagtacccggatctgaac
cctgagtacgacttcaaccagatcgatgccgctcccgaagagcagcagcgtggtatcacc
atcaacattgcccacatcgagtaccagacggccaagcgtcactacgcccacgtcgactgc
ccgggccacgccgacttcgtgaagaacatgatcaccggcgctgcccagatggatggcgcc
atcctcgttgtggccgccaccgacggcccgatggcccagacccgcgagcacgtgctgctc
gcccgtcaggtcggcgtcccgaagatcctcgtcgctctgaacaagtgcgatatggtcgat
gacgaagagctcatcgagctcgtcgaagaagaggtccgcgacctcctcgacgagaacggc
ttcgaccgcgactgcccggtcgtgcacacctccgcttacggcgctctgcatgacgacgct
ccggatcacgacaagtgggttgccaccatcaaggagctcatggacgacgtcgacgagtac
atcccgaccccggtccacgacctcgacaagccgttcctgatgccgatcgaggacgtcttc
accatctccggccgtggcaccgtcgtcaccggtcgtgtcgagcgcggcaagctgccgatc
aacacgaacgtcgagatcgtcggcatccgcccgacccagaccaccaccgtcacctccatc
gagaccttccacaagcagatggatgagtgcgaggccggcgacaacaccggtctgctgctc
cgcggcatcaaccgcaccgacgtcgagcgtggccaggtcgtggctgctccgggttcggtc
accccgcacaccaagttcgaaggcgaagtctacgtccttaccaaggatgagggcggccgt
cactcgccgttcttctcgaactaccgtccgcagttctacttccgcaccaccgacgtcacc
ggcgtcatcacgctgccggaaggcgtcgagatggttcagcctggcgatcacgcgaccttc
acggttgagctgatccagccgatcgctatggaagagggcctcaccttcgcagtgcgtgaa
ggcggccacaccgtcggctcgggccgtgtcaccaagatcctcgcctga

DBGET integrated database retrieval system