KEGG   Bifidobacterium animalis subsp. lactis BLC1: BLC1_0589Help
Entry
BLC1_0589         CDS       T01841                                 

Definition
(GenBank) low specificity-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bbc  Bifidobacterium animalis subsp. lactis BLC1
Pathway
bbc00260  Glycine, serine and threonine metabolism
bbc01100  Metabolic pathways
bbc01110  Biosynthesis of secondary metabolites
bbc01120  Microbial metabolism in diverse environments
bbc01130  Biosynthesis of antibiotics
bbc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLC1_0589
Enzymes [BR:bbc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BLC1_0589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEN76367
Position
complement(724651..725676)
Genome map
AA seq 341 aa AA seqDB search
MLSFENDYSSTAAPQIVARMQAMANEQNSGYGKDQYCDAAANKIRKACDAAQADVWFLVG
GTQTNQTVLSAITPQYAGVVCPESAHINTHEAGAIEATGHKVLALPQHDGKITGEQLDEY
CQSFENDLNHEHMVYPGCVYISQPTEYGTVYTREELASISQVAHDHNLPLYVDGARLGMA
LTADMNDVQLPDLARLADVFTIGGTKCGTMFGEAVVFPRGNSPRNFTTIVKQHGALLAKG
WLLGLQFDTLFTDDLYFKLAKHANAEADKIRKALFEKHYDIEYISQTNQIFIVVTTQRAQ
ELTKSVKLGFMEQVDADHVMLRICTSWATTDEQVDELIKLL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctgtctttcgaaaacgattattcctccaccgccgccccgcagatcgtcgcccgcatg
caggccatggcgaacgaacagaactccggctatggcaaggaccagtattgcgatgcggcc
gcaaacaagattcgcaaagcctgtgatgccgcacaggccgacgtctggttcctcgtggga
ggcacacagacgaaccagaccgtgctcagcgccattaccccgcaatacgcaggcgtcgta
tgcccggagagcgcgcacatcaacacgcacgaggccggcgccatcgaggcgactggacac
aaagtgctcgcactcccccagcacgacggcaagatcaccggcgaacagctcgacgaatac
tgtcagagcttcgaaaacgacctcaaccatgagcatatggtctaccccggctgcgtgtat
atctcgcagcccaccgaatatggcaccgtgtacacgcgtgaggagctcgcctcgatctca
caggtcgcgcatgaccacaatctgcctctctatgtggacggcgcgcggttgggcatggcg
ctcacggcggacatgaacgacgtgcagctgcccgatctcgcccgtctggcggacgtcttc
accattggcggcaccaaatgcggcacgatgttcggagaggccgtcgtgttcccgcgcggt
aattcgccgaggaacttcacgacgatcgtcaagcagcacggtgcactgctggcgaagggc
tggctgttgggactgcagttcgacacgctgttcaccgacgacctctacttcaagctcgcc
aagcatgcgaacgccgaggcggacaagattcgcaaggcactcttcgagaagcattacgac
atcgaatacatctcgcagaccaaccagatcttcatcgtggtgaccacgcagcgcgcgcag
gaactcacgaagtccgtcaagctcggattcatggagcaggtggatgccgaccatgtgatg
ctgcgcatctgcacgagctgggctaccaccgacgagcaggtggacgagctcatcaagctg
ctctga

DBGET integrated database retrieval system