KEGG   Belliella baltica: Belba_0196Help
Entry
Belba_0196        CDS       T02134                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bbd  Belliella baltica
Pathway
bbd00790  Folate biosynthesis
bbd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Belba_0196
Enzymes [BR:bbd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Belba_0196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AFL82865
UniProt: I3Z0U7
Position
complement(204831..205526)
Genome map
AA seq 231 aa AA seqDB search
MKQKETLLNTMGINISRDIDEIGDEHVGTSFETPLREDAFEMDDELKIELIEKHFREIMH
VLGLDLTDDSLKGTPRRVAKMYIQEIFSGLDPKNKPDAKLFENKYKYNEMLVEKDITFFS
NCEHHFVPIYGKAHVAYISNGTVIGLSKINRIVQYFAKRPQVQERLTMQIGNELKEILGT
DDVAVVIDAHHMCVSSRGIKDVNSSTVTSFYSGKFEKEEHTRNEFMKYISL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaaagaaactttgttgaatacgatgggaattaatatcagcagggatattgat
gagattggtgatgaacatgtaggcacatcctttgaaactccccttcgtgaagatgccttt
gaaatggatgatgagcttaaaattgagttgatcgaaaagcacttcagagaaatcatgcat
gttttaggactcgacctgacagatgacagcttgaaaggaactcctaggagagttgctaaa
atgtatatccaagagatttttagtggacttgacccgaaaaacaagcctgacgctaaatta
tttgagaataaatacaaatacaatgagatgttggtggagaaggatatcactttcttttcc
aactgcgaacatcatttcgtgcctatctatgggaaagcgcatgtcgcttatatttctaat
ggtacagtaatcggactttctaaaatcaatagaatagttcagtattttgccaaaagacct
caggttcaagaaagattgactatgcagattggtaatgaattgaaagaaattttgggcaca
gatgatgtggcagttgtcatcgatgcacatcacatgtgtgtttcttcaagaggtataaaa
gacgtgaatagttccacagttacttctttctacagcggtaaatttgaaaaagaagagcat
actagaaatgaatttatgaaatacatttctttataa

DBGET integrated database retrieval system