KEGG   Belliella baltica: Belba_1341Help
Entry
Belba_1341        CDS       T02134                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bbd  Belliella baltica
Pathway
bbd00020  Citrate cycle (TCA cycle)
bbd00310  Lysine degradation
bbd01100  Metabolic pathways
bbd01110  Biosynthesis of secondary metabolites
bbd01120  Microbial metabolism in diverse environments
bbd01130  Biosynthesis of antibiotics
bbd01200  Carbon metabolism
Module
bbd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bbd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Belba_1341
  Amino acid metabolism
   00310 Lysine degradation
    Belba_1341
Enzymes [BR:bbd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Belba_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AFL83965
UniProt: I3Z3Z7
Position
1427549..1429090
Genome map
AA seq 513 aa AA seqDB search
MSLEIKVPTVGESISEVTIGQWFKKDGDFVEMDEVICELESDKATFELAAEAAGILKTMA
AEGDILEIGAVICEINTDGQAGGKIEKSEKPAESSSSSAGGKTGEVKDMIVPTVGESITE
VTLANWLKADGDYVELDEIIAEVDSDKATFELPAEANGILRHVAQEGDTLEIGGLICKIE
VMEGGAPASDDSKEEVSDKSSGTSTSDKETYATGHASPAATKILAEKGISANDVKGTGKD
GRITKEDAEKAEKSAPKPAASKPAESKKEEKSEAAPKVAGSRDSRREKMTSLRKTVSRRL
VSVKNETAMLTTFNEVNMGPIMEMRKKFKDQFKEKHGVNLGFMSFFTKAVCVALQEWPAV
NAQIDGNEIVYNDFCDISIAVSAPKGLVVPVIRNAEAMSFEEIEKEVVRLATKARDNKLS
IEEMTGGTFTLTNGGIFGSMMSTPIINAPQSAILGMHNIVERPMAVNGEVKILPMMYLAL
SYDHRIIDGRESVSFLVRVKQLLEDPTRLLFGV
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgagcctagaaatcaaagtccctaccgtaggggaatctatcagtgaagtgaccattgga
cagtggttcaaaaaagacggcgacttcgtagaaatggatgaagtgatctgtgaattggaa
tccgataaagcaacttttgaattggcagcagaggctgcaggtattttgaaaaccatggca
gctgaaggagatatcttagaaatcggtgctgtgatctgtgaaatcaatactgatggtcaa
gctggaggaaaaattgaaaaatcagaaaaacctgctgaatcttcttcttcatctgcagga
ggaaaaactggcgaggtgaaagatatgatcgttccaacagtaggtgagtcgatcactgaa
gttactttggccaactggctaaaagctgatggagattatgtggaattggacgaaatcatc
gctgaagtagattctgacaaagcaacttttgaacttcctgcggaggcaaatggaattttg
agacatgttgcacaggaaggcgatacgttagaaatcggaggattgatctgtaagattgaa
gtgatggaaggtggagcaccagcatcagacgattctaaggaagaggtctctgataaatct
tcaggtacatctacatctgataaagaaacttatgccacaggtcatgcttctcccgcagct
acgaagattcttgcagaaaaaggaatcagtgccaatgacgtgaaaggaactggcaaggat
ggtagaatcacgaaagaagatgctgaaaaagctgaaaaatctgctcctaaaccagcagca
tcaaaaccagctgaatccaaaaaagaagaaaaatctgaagctgctccaaaggtagctgga
tcaagagatagtagaagagagaaaatgacttctcttcgaaaaactgtttccagaagattg
gtttctgtgaaaaacgaaacagccatgttgaccacgttcaatgaagtgaacatgggtcca
atcatggaaatgagaaagaaattcaaagatcaattcaaggagaagcatggtgtgaacctt
ggtttcatgtctttcttcaccaaagcagtatgcgtggcattgcaagaatggcctgctgtg
aatgctcaaattgatggaaacgaaatcgtttataatgatttctgtgatatttctattgct
gtttctgcgccaaaaggacttgtagttcctgtcatcagaaatgctgaggccatgagcttt
gaagaaatcgaaaaagaagtagtgagattggctaccaaagcgagagacaataaattgtct
attgaggaaatgacaggtggtacattcactttgactaatggtggaatcttcggttccatg
atgtcaactccgatcatcaacgcccctcagtcagcgattcttggaatgcacaatattgta
gaaagaccaatggcagttaacggagaagtaaaaatccttccaatgatgtacttggcactt
tcttatgaccacagaatcattgacggcagagaatccgtaagcttcctggtacgagtgaag
cagcttcttgaagacccgacgaggctgttgtttggagtctaa

DBGET integrated database retrieval system