KEGG   Belliella baltica: Belba_2265Help
Entry
Belba_2265        CDS       T02134                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bbd  Belliella baltica
Pathway
bbd00010  Glycolysis / Gluconeogenesis
bbd00020  Citrate cycle (TCA cycle)
bbd00620  Pyruvate metabolism
bbd01100  Metabolic pathways
bbd01110  Biosynthesis of secondary metabolites
bbd01120  Microbial metabolism in diverse environments
bbd01130  Biosynthesis of antibiotics
bbd01200  Carbon metabolism
Module
bbd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Belba_2265
   00020 Citrate cycle (TCA cycle)
    Belba_2265
   00620 Pyruvate metabolism
    Belba_2265
Enzymes [BR:bbd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Belba_2265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 PYNP_C
Motif
Other DBs
NCBI-ProteinID: AFL84830
UniProt: I3Z6G2
Position
2418771..2420423
Genome map
AA seq 550 aa AA seqDB search
MSDTMEEGVIAAWLKKVGDEVKPGDILAEVETDKATMELESYEEGVLLHIGVEEKDAVPV
NGVIAIIGEKGENIDNLLKEANSGDAPAKSESKSDKEDVKEEKPEKAAEPKESAKTESID
TSGINANLITMPKMSDTMTEGVIASWLKKVGDEIKAGDIIAEVETDKATMELESYDDGIL
LHIGVEAGEAVEIDGVIAVIGEKGADYETLIKAHQSKGGSTEEAQSEVKKEEKAPEKAEE
KKEEKPAPKESSSASSTTDGGRVKASPLAKKLASDKGVDISLVKGSGEGGRIVKRDIESF
DPASVKAPAAKASEGSTSVPALGQESFKEEKVSQMRKVIAKRLAESKFNAPHFYLTMEIN
MDKAIEARKSMNEIAPVKISFNDMVIKAAAAALRQHPKVNSSWLGDKIRYNDHIHIGMAV
AVEEGLLVPVIRFADNKSLSQISNEAKSLGGKAKNKELQPKDWEGNTFTISNLGMFGIDE
FTAIINPPDACIMAVGGIKETVIVKDGQMVIGNLMKVTLSCDHRVVDGAVGSAFLQTFKN
LLEDPVRILI
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaccatggaagaaggggtgatcgcagcgtggttgaagaaagttggtgatgaa
gtaaaaccaggtgatattttagcagaagtggagactgacaaagctaccatggaactagaa
tcttacgaagagggtgttttgcttcacattggtgtggaagaaaaagatgctgtgcctgta
aatggtgtgattgctataattggtgaaaagggagaaaatattgacaatttgctcaaagaa
gcgaatagtggagatgctcccgcaaaatcagaatcaaaaagtgataaggaggacgttaag
gaagaaaagcctgaaaaggctgcagagcctaaagaatccgccaaaactgaatccatcgat
acatctggaatcaatgctaatttgattaccatgcctaaaatgtcagatacgatgacagag
ggagtaattgcttcatggttgaagaaagttggtgatgagatcaaagcaggtgatattatc
gctgaagtggagacagataaagccacgatggagcttgaatcttatgatgatgggatttta
ttgcatatcggagttgaagctggtgaggctgttgaaatagatggtgtgattgctgtgatt
ggagaaaaaggtgcagactatgaaactttgatcaaagcacatcaatctaaaggaggatca
actgaagaggcgcaatcagaagttaaaaaagaagaaaaggctcctgaaaaagctgaggaa
aagaaagaagaaaagcctgcaccgaaagaaagtagttcagcaagctccaccactgatggc
ggaagagtaaaagcttctccacttgccaagaagcttgcatctgacaaaggagttgatatt
tctttggtaaaaggttctggagaaggtggaagaattgtaaaaagagatatagaaagcttt
gatccagcatccgtaaaagctcctgctgccaaagcttcggagggaagtacttcagtgcct
gccttaggtcaagaatccttcaaagaagagaaagtttctcaaatgcgtaaagtgatagct
aagagattggctgaaagtaaattcaatgctcctcatttctacttgaccatggaaatcaac
atggataaggcaattgaagcgagaaaaagtatgaatgaaatagcacctgtgaagatttct
ttcaatgatatggtgatcaaagccgctgcagcggctttgcgtcagcatccaaaagtaaat
tcttcttggttaggtgataaaatcagatacaatgaccacatccacatcggaatggcagta
gctgtagaagaaggacttttggtgcctgtgatcagatttgctgataacaaatccctttct
caaatatcaaatgaagctaaatctcttggaggaaaagccaaaaacaaagaattacagcca
aaagattgggaaggcaacactttcaccatttctaaccttggaatgtttggaattgatgaa
tttacagcaattataaatcctccagatgcttgtataatggcagtaggagggattaaagaa
acggtgatcgtcaaagatggtcagatggtaattggaaacttgatgaaagttaccttatca
tgtgatcatagagtagtcgatggagctgttggttctgcctttctccagactttcaaaaat
cttttggaggatccagttagaatcttgatctaa

DBGET integrated database retrieval system