KEGG   Brevibacillus brevis: BBR47_06920Help
Entry
BBR47_06920       CDS       T00879                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00564  Glycerophospholipid metabolism
bbe01100  Metabolic pathways
bbe01110  Biosynthesis of secondary metabolites
Module
bbe_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBR47_06920 (psd)
Enzymes [BR:bbe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     BBR47_06920 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase DUF3422 UvrC_HhH_N
Motif
Other DBs
NCBI-ProteinID: BAH41669
NITE: BBR47_06920
UniProt: C0Z4E2
Position
728130..728972
Genome map
AA seq 280 aa AA seqDB search
MGKKLLPGLIHRLPQNAMSRTMGKITATPFSRLAIQRYIKHYQIDTSIIEKPASEYRTLK
EFFSRRLKPAARPIAPGPDTIVSPVDGTVSQLGDICEGTLIQAKGKDFSVSELLGGSEEE
AKRYYGGKFITIYLSPRDYHRIHMPVTGDLSSYCYLPGRLYPVNKLGIENVDRLFARNER
LVTHIKTDSLGDMALVKVGALFVGSVKVCYNTATTNIKHGRQTHEKIAGTPRYEKGSELG
WFEFGSTVILLLESNELEWATGVEKGKSLLMGQALATKKA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaaagctgctcccaggtctcatccatcgcttgccacaaaacgcgatgtcacgg
actatgggcaaaattaccgctactccctttagtcgattagccattcaacgatacataaag
cactatcaaattgatacgtcgatcatagaaaagccggcgtcagaataccgtacgctgaag
gagttcttctcccgacgcttgaagcccgcagcgagaccgattgcacctggcccagatacc
atcgtcagcccggtagatggaactgtttcgcagctgggggatatttgcgaaggtaccttg
attcaagcaaagggaaaagatttcagtgtgagtgagctgttgggcggttcggaggaagag
gccaagcgttactacggtggtaaatttatcaccatttatttgagtccaagggattaccac
cggattcatatgccagtaacgggcgatttgagtagttactgctatttgcctggcagactc
tatcccgttaacaagctcgggattgaaaacgtagaccgtttgtttgctcgcaatgaacgc
ttggtaactcacatcaaaacagatagcttgggcgatatggctttggtaaaagtaggagcc
ttgtttgtaggcagcgtgaaggtctgctacaacacagctacgacgaacatcaagcacggt
cgccaaacccacgagaagattgctgggacacctcgttatgaaaaaggctcagagctgggc
tggttcgaatttggatccaccgtcattttgctgttggagtccaacgagctcgaatgggca
acaggcgttgaaaaagggaagtctctcctgatggggcaggcgctcgcgacaaagaaggcg
taa

DBGET integrated database retrieval system