KEGG   Brevibacillus brevis: BBR47_12500Help
Entry
BBR47_12500       CDS       T00879                                 

Gene name
cbiET
Definition
(GenBank) CbiET protein
  KO
K00595  precorrin-6Y C5,15-methyltransferase (decarboxylating) [EC:2.1.1.132]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00860  Porphyrin and chlorophyll metabolism
bbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BBR47_12500 (cbiET)
Enzymes [BR:bbe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.132  precorrin-6B C5,15-methyltransferase (decarboxylating)
     BBR47_12500 (cbiET)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase Methyltransf_18 Methyltransf_31 Methyltransf_25 MTS PCMT Methyltransf_11 Methyltransf_4
Motif
Other DBs
NCBI-ProteinID: BAH42227
NITE: BBR47_12500
UniProt: C0Z7I4
Position
1276131..1277360
Genome map
AA seq 409 aa AA seqDB search
MTQAMKVIGIGDDGQQSLLPLYRTWIEESELLVGGERHLSFFPEYTGEKRVLKGGLTAMV
EELRTETRKTVILASGDPLFYGIGGLLSKKLNVEIYPHLSSIQLAFAKMGESWQDATLAS
VHGRSIKGLAQRIDGKDKVALLTDRENSPAAIARYLLSFQMNEYDAFVAENLGSAEERTG
WYSLEEMADGSFSDLNVVILKKRRPSPVWPFGIADEEFSQRKPDKGLITKKEVRILSIAQ
LQLHAKSIVWDIGTCTGSVAIEAARIAREGEVYGVEKNVDDLENCRQNMAKFRTDLTVIN
ARAPHGLDEFPDPDAVFIGGSGGELRELLNICCTRLRPNGRIVVNAATIETLYEATQAFA
QEGFETSVTLAQLSRSKPILSLTRFEALNPIYIITAWAKQAEEQGGDSK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacacaggcgatgaaagtaattggaatcggggatgatggacagcagagcctgctgccg
ctgtaccggacttggatagaggaaagtgaactgttagttggaggagagcggcacctcagc
tttttcccggagtatacaggggaaaagcgtgtactaaagggcggactgaccgcgatggta
gaagagctacgcacagagacacgcaagacggtcattctggcgtcaggcgacccgctcttt
tacgggataggtggcttactttccaaaaagctgaacgtggagatttacccgcacctcagc
tccattcagctcgcttttgccaaaatgggcgaatcatggcaggatgcgacattggcaagt
gtgcacggacgtagtatcaaaggtctggcgcaacggatcgacgggaaggataaggtcgct
cttttgacggatcgggaaaactcgccagcagcgattgcccgctatctcctttcgttccaa
atgaatgagtacgatgcgttcgtggcggagaacctcggcagtgccgaagagcggacaggc
tggtattcccttgaggaaatggctgatggtagcttctctgatctgaatgtcgtgattttg
aaaaaacgtcgtccaagcccggtgtggccgtttggaatcgcagacgaggagttttcccag
cgcaaaccggacaagggacttattacgaaaaaagaagtgcgcattttaagcattgcacag
ctgcaattgcatgcgaaaagcatcgtctgggacatcggcacctgcacaggctctgtcgcc
attgaagcggcacgaattgcgcgtgagggtgaagtgtacggcgtagagaagaacgtggac
gatctggaaaactgccgccagaacatggcgaagtttcgcacggatttgacagtgattaac
gcacgcgccccacatggcttggatgagttcccggacccggatgccgtatttatcggcggc
agtggtggagaattgcgagagctgttgaacatctgctgcacacgactgcgcccgaatggc
cggatcgtggtgaatgcagcgaccattgagacattgtacgaagcgacacaagcattcgcg
caagaaggattcgagacatcggtgacactggcgcagctatcgcgcagcaagccgattttg
tccctgacgcgctttgaagcattgaatccgatctacatcattacggcctgggccaagcag
gcagaagaacaaggaggagacagcaagtga

DBGET integrated database retrieval system